IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chae-2008-6 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. arath-flower Arabidopsis thaliana flower flower Flower ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Chae E., Tan QK., Hill TA., Irish VF. Extracts from inflorescence tissue from transgenic plants were used in this study. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation chae-2008-1 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chae E., Tan QK., Hill TA., Irish VF. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation chae-2008-3 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chae E., Tan QK., Hill TA., Irish VF. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation chae-2008-2 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chae E., Tan QK., Hill TA., Irish VF. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation chae-2008-4 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chae E., Tan QK., Hill TA., Irish VF. Transgenic Arabidopsis plants expressing epitope tagged proteins of interest were used in this study. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation chae-2008-5 An Arabidopsis F-box protein acts as a transcriptional co-factor to regulate floral development. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chae E., Tan QK., Hill TA., Irish VF. Transgenic arabidopsis plants expressing MYC tagged UFO protein were used in this study. vivian.irish@yale.edu Development (0950-1991) 2008 Only protein-protein interactions imex curation ap3_arath_gene AP3 Arabidopsis thaliana gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress lfy_arath Protein LEAFY LFY MAC9.18 At5g61850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPEGFTSGLFRWNPTRALVQAPPPVPPPLQQQPVTPQTAAFGMRLGGLEGLFGPYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLSHIFRWELLVGERYGIKAAVRAERRRLQEEEEEESSRRRHLLLSAAGDSGTHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGGSGYWDAGQGKMKKQQQQRRRKKPMLTSVETDEDVNEGEDDDGMDNGNGGSGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAVAAAAALVGGISCTGSSTSGRGGCGGDDLRF ufo_arath Protein UNUSUAL FLORAL ORGANS F-box only protein 1 UFO At1g30950 F17F8.16 FBX1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC ap1_arath_gene AP1_ Arabidopsis thaliana_gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress lfy-dna LFY and regions of the AP3 promoter interact 728388 n/a 728394 unspecified role unspecified role prey prey dee_and_pee_promoter_regions binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728395 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 4B The authors state that "LFY specifically associates with both the DEE and PEE elements of the AP3 promoter". However no coordinates of these regions are provided. ufo-dna-1 UFO and regions of the AP3 promoter interact 728388 N/A 728396 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728395 unspecified role unspecified role ancillary ancillary c_terminal_region required to bind necessary binding region required to bind range range range range false n/a 728394 unspecified role unspecified role prey prey dee_and_pee_promoter_regions binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 4C The authors state that the results demonstrates that "that LFY is required for UFO to associate with AP3 promoter sequences" lfy-dna-1 LFY and regions of the AP1 promoter interact 728388 n/a 728397 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728395 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 4B ufo-lfy-2 LFY and UFO interact on the APT3 promoter 728389 N/A 728395 unspecified role unspecified role neutral component neutral component in vitro In vitro N/A 728396 unspecified role unspecified role neutral component neutral component in vitro In vitro n/a 728394 unspecified role unspecified role neutral component neutral component promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2A The DNA probe was labelled with 32P ap3-lfy LFY and UFO interact on the APT3 promoter 728389 n/a 728395 unspecified role unspecified role neutral component neutral component in vitro In vitro n/a 728394 unspecified role unspecified role neutral component neutral component promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2Ai The DNA probe was labelled with 32P lfy-ufo-1 LFY and UFO interact 728390 N/A 728396 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 728395 unspecified role unspecified role bait bait physical association physical association false false false Figure 2C ufo-lfy LFY and UFO interact 728390 N/A 728395 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728396 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2C, Figure 3B The interaction only took place if F-box was deleted. lfy-ufo LFY and UFO interact 728391 N/A 728396 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 728395 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 2B ufo-lfy-1 LFY and UFO interact 728392 N/A 728396 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728395 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2D lfy-ufo-2 LFY and UFO interact 728393 N/A 728395 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 728396 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 3C It was demonstrated that deletion of 1-375 amino acids of the LFY protein reduced interaction with the GST tagged UFO protein.