MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tamura-2007-1 p40phox as an alternative organizer to p47phox in Nox2 activation: a new mechanism involving an interaction with p22phox. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Tamura M., Shiozaki I., Ono S., Miyano K., Kunihiro S., Sasaki T. tamura@eng.ehime-u.ac.jp FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation ncf4_human Neutrophil cytosol factor 4 NCF4 Neutrophil NADPH oxidase factor 4 p40-phox SH3 and PX domain-containing protein 4 SH3PXD4 protein protein human Homo sapiens Human MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP cy24a_human Cytochrome b-245 light chain p22 phagocyte B-cytochrome Neutrophil cytochrome b 22 kDa polypeptide p22-phox Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Superoxide-generating NADPH oxidase light chain subunit CYBA protein protein human Homo sapiens Human MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV ncf4-cyba 724241 ncf4_human p40phox 724242 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q15080:p.Trp207Arg mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cy24a_human p22PR 724243 peptide synthesis peptide synthesis unspecified role unspecified role prey prey purified purified P13498:p.Pro156Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F7B F7C homomint mint ncf1-cyba-7 724241 ncf1_human p47phox 724244 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified cy24a_human p22PR 724243 peptide synthesis peptide synthesis unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P13498:p.Pro156Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F7B F7C homomint mint