IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tan-2006-3 The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tan QK., Irish VF. The authors use the following scoring scheme to indicate strength of protein interaction , ++++ (very strong), +++ (strong), ++(moderate), + (weak), +- (very weak). This scoring system was based on time taken for colonies of transformed yeasts to turn blue. Unfortunately the timings for the scoring system are not provided by the authors. vivian.irish@yale.edu Plant Physiol. (0032-0889) 2006 tan-2006-2 The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tan QK., Irish VF. vivian.irish@yale.edu Plant Physiol. (0032-0889) 2006 tan-2006-1 The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid predetermined predetermined participant predetermined Tan QK., Irish VF. vivian.irish@yale.edu Plant Physiol. (0032-0889) 2006 zhd3_arath Zinc-finger homeodomain protein 3 ZHD3 HB21 Homeobox protein 21 ZFHD4 Zinc finger homeodomain transcription factor 4 T8K22.16 At2g02540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIASQEDPIPINTSYGNSGGGHGNMNHHHHANSAPSSLNITTSNPLLVSSNSNGLGKNHDHSHHHHVGYNIMVTNIKKEKPVVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCSVCNCHRNFHRRETEGEEKTFFSPYLNHHQPPPQQRKLMFHHKMIKSPLPQQMIMPIGVTTAGSNSESEDLMEEEGGGSLTFRQPPPPPSPYSYGHNQKKRFRTKFTQEQKEKMISFAERVGWKIQRQEESVVQQLCQEIGIRRRVLKVWMHNNKQNLSKKSNNVSNNVDLSAGNNDITENLASTNP zhd2_arath Zinc-finger homeodomain protein 2 ZHD1 HB22 Homeobox protein 22 MEE68 Protein MATERNAL EFFECT EMBRYO ARREST 68 F22K18.140 At4g24660 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNFEDQEEDMEMSGVNPPCGYDSLSGEGATSSGGGGVGRSKGVGAKIRYRECLKNHAVNIGGHAVDGCCEFMPSGEDGTLDALKCAACGCHRNFHRKETESIGGRAHRVPTYYNRPPQPHQPPGYLHLTSPAAPYRPPAASGDEEDTSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKKP zhd10_arath Zinc-finger homeodomain protein 10 ZHD10 HB23 Homeobox protein 23 MKM21.8 At5g39760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMDMTPTITTTTTPTPKSPEPESETPTRIQPAKPISFSNGIIKRHHHHHHPLLFTYKECLKNHAAALGGHALDGCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPDNNNDSSQIPPPPSTAVEYQPHHRHHPPPPPPPPPPRSPNSASPPPISSSYMLLSLSGTNNNNNNLASFSDLNFSAGNNHHHHHQHTLHGSRKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRDIAGNEIRQIDNGGGNHTPILAGEINNHNNGHHGVGGGGELHQSVSSGGGGGGFDSDSGGANGGNVNGSSSS zhd1_arath Zinc-finger homeodomain protein 1 ZHD1 HB25 Homeobox protein 25 ZFHD2 Zinc finger homeodomain transcription factor 2 MNA5.14 At5g65410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFEDNNNNNDEEQEEDMNLHEEEEDDDAVYDSPPLSRVLPKASTESHETTGTTSTGGGGGFMVVHGGGGSRFRFRECLKNQAVNIGGHAVDGCGEFMPAGIEGTIDALKCAACGCHRNFHRKELPYFHHAPPQHQPPPPPPGFYRLPAPVSYRPPPSQAPPLQLALPPPQRERSEDPMETSSAEAGGGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTLGKSPSPLHHHQAPPPPPPQSSFHHEQDQP zhd11_arath Zinc-finger homeodomain protein 11 ZHD11 HB29 Transcription factor HB29 ZFHD1 Zinc finger homeodomain transcription factor 1 F24J1.29 At1g69600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSSKPQQQLLNSLPIAGELTVTGEMGVCYKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFLTAPPISSPSGTESPPSRHVSSPVPCSYYTSAPPHHVILSLSSGFPGPSDQDPTVVRSENSSRGAMRKRTRTKFTPEQKIKMRAFAEKAGWKINGCDEKSVREFCNEVGIERGVLKVWMHNNKYSLLNGKIREIEHGLCLNTHSNDGDGSSSS zhd5_arath Zinc-finger homeodomain protein 5 ZHD5 HB33 Homeobox protein 33 F22H5.4 At1g75240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDMRSHEMIERRREDNGNNNGGVVISNIISTNIDDNCNGNNNNTRVSCNSQTLDHHQSKSPSSFSISAAAKPTVRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCAACDCHRNFHRKEMDGVGSSDLISHHRHHHYHHNQYGGGGGRRPPPPNMMLNPLMLPPPPNYQPIHHHKYGMSPPGGGGMVTPMSVAYGGGGGGAESSSEDLNLYGQSSGEGAGAAAGQMAFSMSSSKKRFRTKFTTDQKERMMDFAEKLGWRMNKQDEEELKRFCGEIGVKRQVFKVWMHNNKNNAKKPPTPTTTL zhd6_arath Zinc-finger homeodomain protein 6 ZHD6 HB24 Homeobox protein 24 T30D6.14 At2g18350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVREKKDEKMEMTRRKSSALDHHRLPPYTYSQTANKEKPTTKRNGSDPDPDPDLDTNPISISHAPRSYARPQTTSPGKARYRECQKNHAASSGGHVVDGCGEFMSSGEEGTVESLLCAACDCHRSFHRKEIDGLFVVNFNSFGHSQRPLGSRHVSPIMMSFGGGGGCAAESSTEDLNKFHQSFSGYGVDQFHHYQPKKRFRTKFNEEQKEKMMEFAEKIGWRMTKLEDDEVNRFCREIKVKRQVFKVWMHNNKQAAKKKDL zhd7_arath Zinc-finger homeodomain protein 7 ZHD7 HB28 Homeobox protein 28 F18B3.170 At3g50890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MELGGKCNAITTTTMISTEVKPHTDPEPEAKPESDPSMALFPIKKENQKPKTRVDQGAKYRECQKNHAASTGGHVVDGCCEFMAGGEEGTLGALKCAACNCHRSFHRKEVYGHRNSKQDHQLMITPAFYSSNSSYKPRVMHPTGEIGRRTSSSSEDMKKILSHRNQNVDGKSLMMMMMRKKKRVRTKINEEQKEKMKEFAERLGWRMQKKDEEEIDKFCRMVNLRRQVFKVWMHNNKQAMKRNNSNISE zhd8_arath Zinc-finger homeodomain protein 8 ZHD8 HB30 Homeobox protein 30 ZFHD3 Zinc finger homeodomain transcriptional factor ZFHD3 F8M21.100 At5g15210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDVIATTTTIVSDLDSRQPEIEAPIRIQPAKPISFSNGKRCHHHHLASEAVAVATYKECLKNHAAGIGGHALDGCGEFMPSPSFNSNDPASLTCAACGCHRNFHRREEDPSSLSAIVPAIEFRPHNRHQLPPPPPPHLAGIRSPDDDDSASPPPISSSYMLLALSGGRGGANTAVPMSRKRFRTKFSQYQKEKMFEFSERVGWRMPKADDVVVKEFCREIGVDKSVFKVWMHNNKISGRSGARRANGGVVVGGVGDSRQSVVPTNGSFSST zhd4_arath Zinc-finger homeodomain protein 4 ZHD4 FTM2 HB31 Homeobox protein 31 Protein FLORAL TRANSITION AT THE MERISTEM 2 F14L17.21 At1g14440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIASQEDHDMPIPLNTTFGGGGSHGHMIHHHDHHAANSAPPTHNNNNTTQPPPMPLHGNGHGNNYDHHHHQDPHHVGYNAIIKKPMIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGELAATAMSPYHQHPPHRKLMLNHQKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGVTTASRSLPNLPYNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVLKVWMHNNKIHFSKKNNINLEDNDNEKINNLNNVDLSGNNDMTKIVP zhd9_arath Zinc-finger homeodomain protein 9 ZHD9 HB34 Homeobox protein 34 MYI13.1 At3g28920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLEVRSMDMTPKSPEPESETPTRIQPAKPISFSNGIIKRHHHHHHNNNKVTYKECLKNHAAAIGGHALDGCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRETDDSSAVPPPSLLPSSTTTAAIEYQPHHRHHPPPPLAPPLPRSPNSSSPPPISSSYMLLALSGNNKTAPFSDLNFAAAANHLSATPGSRKRFRTKFSSNQKEKMHEFADRIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNSFKFSGGGATTVQRNDNGIGGENSNDDGVRGLANDGDGGGGRFESDSGGADGGGNVNASSSSS zhd13_arath Zinc-finger homeodomain protein 13 ZHD13 HB27 Homeobox protein 27 MJB21.16 At5g42780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEIKPKKEENSKRRRNVKPICRETGDHVHYLPTCKTKPKPTRTHHAPPPILDSIFKVTHKPHYYECRKNHAADIGTTAYDGCGEFVSSTGEEDSLNCAACGCHRNFHREELIPENGGVTETVLEVLKISSCQFRRIFCSPYGGGKSEGKKKKKEKESYGGDPIIKDRFGGAEEEEGIVKRLKTKFTAEQTEKMRDYAEKLRWKVRPERQEEVEEFCVEIGVNRKNFRIWMNNHKDKIIIDE zhd12_arath Zinc-finger homeodomain protein 12 ZHD12 HB26 Homeobox protein 26 MUF9.11 At5g60480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLSKPNRQFLSPTTNNQDTGREQTIACARDMVVLYNECLKNHAVSLGGHALDGCGEFTPKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQHRSPPSPLQLQPLAPVPNLLLSLSSGFFGPSDQEVKNKFTVERDVRKTAMIKKHKRTKFTAEQKVKMRGFAERAGWKINGWDEKWVREFCSEVGIERKVLKVWIHNNKYFNNGRSRDTTSSMSLNLKL zhd14_arath Zinc-finger homeodomain protein 14 ZHD14 HB32 Homeobox protein 32 F10B6.7 At1g14687 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQSTCVYRECMRNHAAKLGSYAIDGCREYSQPSTGDLCVACGCHRSYHRRIDVISSPQINHTRFPFTSLRRVKQLARLKWKTAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQREAMKDYAAKLGWTLKDKRALREEIRVFCEGIGVTRYHFKTWVNNNKKFYH oligo-arath-dna Consensus sequence oligonucleotide nucleic acid nucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TTGATTTAAACAGTGTCTTG This was a concensus sequence oligonucleotide used in a study by Tan and Irish (2006) PMID 16428600. oligo-arath-dna-1 Consensus sequence oligonucleotide nucleic acid nucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress CAGTGTCTTGTAATTAAAAA This was a concensus sequence oligonucleotide used in Tan and Irish (2006) PMID 16428600 oligo-arath-dna-3 Mutated consensus sequence oligonucleotide nucleic acid nucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress CAGTGTCTTGGGATTAAAAA This is a mutated concensus sequence oligonucleotide used by Tan and Irish (2006) PMID 16428600. ap3-arath-dna APETALA 3 promoter region dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress The authors state that a region -285 to -83 of the promoter was dimerized and used in this study and reference Hill et al (19998) PMID 9521909. atbh21-atbh22 762951 N/A 762954 unspecified role unspecified role bait bait N/A 762955 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh21-atbh23 762951 N/A 762954 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. -+ (very weak) Table 1 -+ (very weak) atbh21-atbh25 762951 N/A 762957 unspecified role unspecified role prey prey N/A 762954 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh21-atbh29 762951 N/A 762954 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh21-atbh33 762951 N/A 762959 unspecified role unspecified role prey prey N/A 762954 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh22-atbh21 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762954 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh22 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762955 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh23 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh24 762951 N/A 762960 unspecified role unspecified role prey prey N/A 762955 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh25 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh22-atbh28 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762961 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh29 762951 N/A 762958 unspecified role unspecified role prey prey N/A 762955 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh30 762951 N/A 762955 unspecified role unspecified role bait bait N/A 762962 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh31 762951 N/A 762963 unspecified role unspecified role prey prey N/A 762955 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh22-atbh33 762951 N/A 762959 unspecified role unspecified role prey prey N/A 762955 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh22-atbh34 762951 N/A 762964 unspecified role unspecified role prey prey N/A 762955 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh23-atbh21 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762954 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh23-atbh22 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762955 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh23-atbh23 762951 N/A 762956 unspecified role unspecified role prey prey N/A 762956 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh23-atbh24 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762960 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh23-atbh25 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh23-atbh28 762951 N/A 762961 unspecified role unspecified role prey prey N/A 762956 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh23-atbh29 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh23-atbh30 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762962 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh23-atbh31 762951 N/A 762963 unspecified role unspecified role prey prey N/A 762956 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh23-atbh33 762951 N/A 762956 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh23-atbh34 762951 N/A 762964 unspecified role unspecified role prey prey N/A 762956 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh24-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762960 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh24-atbh23 762951 N/A 762960 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh24-atbh25 762951 N/A 762957 unspecified role unspecified role prey prey N/A 762960 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh24-atbh29 762951 N/A 762958 unspecified role unspecified role prey prey N/A 762960 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh24-atbh31 762951 N/A-x-x-x-x-x 762960 unspecified role unspecified role bait bait N/A 762963 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh25-atbh21 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762954 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh25-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762957 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh23 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh25-atbh24 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762960 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh25-atbh25 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh25-atbh27 762951 N/A 762965 unspecified role unspecified role prey prey N/A 762957 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh25-atbh28 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762961 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh29 762951 N/A 762958 unspecified role unspecified role prey prey N/A 762957 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh30 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762962 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh31 762951 N/A 762963 unspecified role unspecified role prey prey N/A 762957 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh33 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh25-atbh34 762951 N/A 762957 unspecified role unspecified role bait bait N/A 762964 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh27-atbh23 762951 N/A-x 762965 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh27-atbh25 762951 N/A 762957 unspecified role unspecified role prey prey N/A 762965 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh27-atbh29 762951 N/A-x-x 762965 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh28-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762961 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh28-atbh23 762951 N/A 762956 unspecified role unspecified role prey prey N/A 762961 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh28-atbh25 762951 N/A 762961 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh28-atbh31 762951 N/A 762961 unspecified role unspecified role bait bait N/A 762963 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh29-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh29-atbh21 762951 N/A 762954 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". +++ (strong) atbh29-atbh23 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). ++++ (very strong) atbh29-atbh24 762951 N/A 762960 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". ++++ (very strong) atbh29-atbh25 762951 N/A 762957 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). ++++ (very strong) atbh29-atbh26 762951 N/A 762966 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". +++ (strong) atbh29-atbh27 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762965 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). +++ (strong) atbh29-atbh28 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762961 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". +++ (strong) atbh29-atbh29 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". ++ (moderate) atbh29-atbh30 762951 N/A 762962 unspecified role unspecified role prey prey N/A 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). +++ (strong) atbh29-atbh31 762951 N/A 762963 unspecified role unspecified role prey prey N/A-x-x-x-x-x-x-x-x 762958 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". ++++ (very strong) atbh29-atbh32 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762967 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). +++ (strong) atbh29-atbh33 762951 N/A 762958 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". ++++ (very strong) atbh29-atbh34 762951 N/A-x-x-x 762958 unspecified role unspecified role bait bait N/A 762964 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 The authors conclude that "when linked to the AD, ATHB29 interacts with virtually all family members. This is an interesting finding, since ATHB29 could potentially serve as the partner that confers activation of transcription, whereas the other partner could dictate DNA-binding specificity. According to the northern data, the ATHB29 gene is expressed at high levels in flowers only, with low expression in roots (Fig. 5). It is likely that ATHB29 confers floral specificity on the transcriptional complex containing ZF-HD family members". The authors note that "ATHB29 possesses its own activation domain, since the construct with ATHB29 linked to BD could activate reporter gene expression when coexpressed with just the AD alone". In this case interaction strength is shown as ++ (moderate). +++ (strong) atbh30-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh30-atbh23 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh30-atbh24 762951 N/A 762956 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh30-atbh25 762951 N/A 762957 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh30-atbh28 762951 N/A 762961 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh30-atbh29 762951 N/A 762958 unspecified role unspecified role prey prey N/A 762962 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh30-atbh30 762951 N/A 762962 unspecified role unspecified role bait bait N/A 762962 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh30-atbh31 762951 N/A 762962 unspecified role unspecified role bait bait N/A 762963 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh30-atbh33 762951 N/A 762962 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh28-atbh29 762951 N/A-x 762961 unspecified role unspecified role bait bait N/A-x 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh31-atbh22 762951 N/A 762955 unspecified role unspecified role prey prey N/A 762963 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh31-atbh21 762951 N/A 762954 unspecified role unspecified role prey prey N/A 762963 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh31-atbh23 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762956 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh31-atbh24 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762960 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh31-atbh25 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh31-atbh28 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762961 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh31-atbh29 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh31-atbh30 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762962 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh31-atbh31 762951 N/A 762963 unspecified role unspecified role bait bait N/A 762963 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh31-atbh33 762951 N/A 762959 unspecified role unspecified role prey prey N/A 762963 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh32-atbh29 762951 N/A 762958 unspecified role unspecified role prey prey N/A 762967 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh32-atbh25 762951 N/A-x-x 762967 unspecified role unspecified role bait bait N/A 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh33-atbh21 762951 N/A-x 762959 unspecified role unspecified role bait bait N/A-x 762954 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh33-atbh22 762951 N/A-x 762955 unspecified role unspecified role prey prey N/A-x 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh33-atbh23 762951 N/A-x 762956 unspecified role unspecified role prey prey N/A-x 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh33-atbh25 762951 N/A-x 762957 unspecified role unspecified role prey prey N/A-x 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh33-atbh28 762951 N/A-x-x-x-x-x 762961 unspecified role unspecified role prey prey N/A 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh33-atbh29 762951 N/A-x 762959 unspecified role unspecified role bait bait N/A-x 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh33-atbh30 762951 N/A-x-x-x-x-x-x-x-x 762962 unspecified role unspecified role prey prey N/A-x 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh33-atbh31 762951 N/A 762963 unspecified role unspecified role prey prey N/A 762959 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh33-atbh33 762951 N/A-x-x 762959 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh34-atbh22 762951 N/A-x-x 762955 unspecified role unspecified role prey prey N/A-x 762964 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh34-atbh23 762951 N/A 762956 unspecified role unspecified role prey prey N/A 762964 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) atbh34-atbh24 762951 N/A 762960 unspecified role unspecified role prey prey N/A-x-x 762964 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh34-atbh25 762951 N/A-x 762964 unspecified role unspecified role bait bait N/A-x-x-x-x-x-x-x-x 762957 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++++ (very strong) Table 1 ++++ (very strong) atbh34-atbh28 762951 N/A 762964 unspecified role unspecified role bait bait N/A 762961 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + (weak) Table 1 + (weak) atbh34-atbh29 762951 N/A 762964 unspecified role unspecified role bait bait N/A 762958 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ (strong) Table 1 +++ (strong) atbh34-atbh30 762951 N/A 762962 unspecified role unspecified role prey prey N/A 762964 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh34-atbh31 762951 N/A 762964 unspecified role unspecified role bait bait N/A 762963 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +- (very weak) Table 1 +- (very weak) atbh34-atbh33 762951 N/A-x-x-x-x 762964 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ (moderate) Table 1 ++ (moderate) at1g75240-dna-1 At1g75240 binds a concensus sequence oligonucleoide 762952 N/A 762968 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3B at1g75240-dna-2 At1g75240 binds a concensus sequence oligonucleoide 762952 N/A 762959 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 762969 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3C Figure 3D The authors state that "competition assays were used to assess the ability of these oligonucleotides to disrupt binding of ATHB33 to the B fragment. The relative strength of competition was BM1 > BM2 > BM4 > BM3, indicating that the mutated bases in BM4 and BM3 were the least effective in disrupting binding. Together, these results show that ATHB33 binds to a core consensus sequence of ATTA, similar to that of other HD-containing proteins". at1g75240-dna-3 At1g75240 binds a concensus sequence oligonucleoide 762952 N/A 762970 unspecified role unspecified role bait bait N/A-x-x 762959 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3C at1g75240-dna-4 At1g75240 binds a concensus sequence oligonucleoide 762952 N/A 762968 unspecified role unspecified role bait bait N/A-x 762959 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3B at1g75240-dna At1g75240 binds the APETALA 3 promoter 762953 N/A 762971 unspecified role unspecified role bait bait N/A 762959 unspecified role unspecified role prey prey Q9FRL5:p.Met292Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9FRL5:p.Met292Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 The authors state that "yeast one-hybrid assays were used to delimit the domain to which ATHB33 binds to 30 bp of the original 202-bp promoter fragment (data not shown)".