IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sugimoto_sh-2005-1 RHL1 is an essential component of the plant DNA topoisomerase VI complex and is required for ploidy-dependent cell growth. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sugimoto-Shirasu K., Roberts GR., Stacey NJ., McCann MC., Maxwell A., Roberts K. keiko.sugimoto@bbsrc.ac.uk Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Only protein-protein interactions imex curation sugimoto_sh-2005-2 RHL1 is an essential component of the plant DNA topoisomerase VI complex and is required for ploidy-dependent cell growth. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Sugimoto-Shirasu K., Roberts GR., Stacey NJ., McCann MC., Maxwell A., Roberts K. keiko.sugimoto@bbsrc.ac.uk Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Only protein-protein interactions imex curation top6a_arath DNA topoisomerase 6 subunit A TOP6A SPO11-3 BIN5 At5g02820 RHL2 Protein BRASSINOSTEROID INSENSITIVE 5 Protein ROOT HAIRLESS 2 Meiotic recombination protein SPO11-3 F9G14.130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADKKKRKRSKDDEAEELPFKSILESDDVITELLKSYISSSIKAAAGAGGASSSSSKPLTLADLSLSSSCREVADLSLSSVQTEIETVIVQIARSILAGDGFSFSVPSRAASNQLYVPELDRIVLKDKSTLRPFASVSSVRKTTITTRILALIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVSCMLGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYMRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL top6b_arath DNA topoisomerase 6 subunit B TOP6B At3g20780 BIN3 HYP6 RHL3 Protein BRASSINOSTEROID INSENSITIVE 3 Protein ROOT HAIRLESS 3 Protein ELONGATED HYPOCOTYL 6 MOE17.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGDDLVETKKGSSKNSKDSNESKLKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENALDSAESISELPEVEVTIEEIVKSKFNSMIGLIDRERVDTQLYDDYETEKARGKRLAKEARASEIQAKNLASGKKNKEPGVSKVLKARGEASYYKVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTGLPIEISSSMKSQNYVTFCRLDIDIHRNIPHIHLHEKKGNKEKWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFLFRFISETPEKNVTIKFTRRTDVMPPIPIETKHHPSSVDLLLIKRLITDTSKKTLLQFLQNEFVNINKTLAARLIGEMGPDFGPSMAVKSVTSQQMVRIHQLFRQAKFDDPSGDCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAGVSLGGRDVKQGINIFRFANRIPLLFEQGADVVTRTALKRINWNSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDISEIATAVKSAIQQCCIQLKSKIVKRLQAREQQERKRSLSRYIPDATGAVYEVLKQMTEEHKTKRKRYGEEDIVMLDKVSKQIITKETLKEKLAEHVEQVDYEMALEYATQSGVSEEPRENIYLQHLDPNKSNFIDLHSPTFVFRLML rhl1_arath DNA-binding protein RHL1 RHL1 HYP7 At1g48380 Protein ROOT HAIRLESS 1 Protein ELONGATED HYPOCOTYL 7 F11A17.7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRASSSKKGGSKGGDKDDAESKQRKRLKTLALDNQLLSDSPAKSHSSLKPSKQVLKHHGTDIIRKSQRKNRFLFSFPGLLAPISAATIGDLDRLSTKNPVLYLNFPQGRMKLFGTILYPKNRYLTLQFSRGGKNVLCDDYFDNMIVFSESWWIGTKEENPEEARLDFPKELAQAENTEFDFQGGAGGAASVKKLASPEIGSQPTETDSPEVDNEDVLSEDGEFLDDKIQVTPPVQLTPPVQVTPVRQSQRNSGKKFNFAETSSEASSGESEGNTSDEDEKPLLEPESSTRSREESQDGNGITASASKLPEELPAKREKLKSKDSKLVQATLSNLFKKAEEKTAGTSKAKSSSKA pbr322-ecoli-dna E.coli pBR322 plasmid dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid ecolx Escherichia coli at5g02820-at5g02820 At5g02820 (RHL2) homodimer 736240 N/A 736242 unspecified role unspecified role bait bait N/A 736242 unspecified role unspecified role prey prey physical association physical association false false false Figure 4C BAIT:At5g02820/F9G14_130 is RLH2; PREY:At5g02820/F9G14_130 is RLH2 at5g02820-top6b At5g02820 (RHL2) interacts with Top6B (RHL3) 736240 N/A 736242 unspecified role unspecified role bait bait N/A 736243 unspecified role unspecified role prey prey physical association physical association false false false Figure 4C BAIT: At5g02820/F9G14_130 is RLH2 at5g02820-rhl1 At5g02820 (RHL2) interacts with RHL1 736240 N/A 736244 unspecified role unspecified role prey prey N/A 736242 unspecified role unspecified role bait bait physical association physical association false false false Figure 4C BAIT: At5g02820/F9G14_130 is RLH2 top6b-at5g02820 Top6B (RHL3) interacts with At5g02820 (RHL2) 736240 N/A 736242 unspecified role unspecified role prey prey N/A 736243 unspecified role unspecified role bait bait physical association physical association false false false Figure 4C PREY: At5g02820/F9G14_130 is RLH2 top6b-top6b Top6B (RHL3) homodimer 736240 N/A 736243 unspecified role unspecified role bait bait N/A 736243 unspecified role unspecified role prey prey physical association physical association false false false Figure 4C pbr322_dna-rhl1 147 base pair region of the pBR322 plasmid interacts with RHL1 protein 736241 N/A 736245 unspecified role unspecified role bait bait N/A 736244 unspecified role unspecified role prey prey n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 4D the authors conclude "RHL1 binds to DNA in a concentration- and salt-dependent manner". the authors do not provide the sequence of the 147 base pair region used in this study , it cannot therefore be represented in this entry. pbr322_dna-rhl1-1 147 base pair region of the pBR322 plasmid interacts with RHL1 protein 736241 N/A 736245 unspecified role unspecified role bait bait N/A 736244 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal S tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 4D the authors conclude "RHL1 binds to DNA in a concentration- and salt-dependent manner". the authors do not provide the sequence of the 147 base pair region used in this study , it cannot therefore be represented in this entry.