UniProt UniProt http://www.uniprot.org khurana-2005-3 A Rab21/LIM-only/CH-LIM complex regulates phagocytosis via both activating and inhibitory mechanisms. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Khurana T., Brzostowski JA., Kimmel AR. ark1@helix.nih.gov A cDNA library from 8h-16h development was used. EMBO J. (0261-4189) 2005 Only protein-protein interactions imex curation khurana-2005-1 A Rab21/LIM-only/CH-LIM complex regulates phagocytosis via both activating and inhibitory mechanisms. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Khurana T., Brzostowski JA., Kimmel AR. ark1@helix.nih.gov A cDNA library from 8h-16h development was used. EMBO J. (0261-4189) 2005 Only protein-protein interactions imex curation khurana-2005-2 A Rab21/LIM-only/CH-LIM complex regulates phagocytosis via both activating and inhibitory mechanisms. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Khurana T., Brzostowski JA., Kimmel AR. ark1@helix.nih.gov A cDNA library from 8h-16h development was used. EMBO J. (0261-4189) 2005 Only protein-protein interactions imex curation limch_dicdi Calponin homology and LIM domain-containing protein ChLim DDB_G0267490 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MIKANWTSTSAFNLELALDESRDWIERVINQKFPSDFQSSLRDGIFLCKLINQIQPNSVPKYNQSPSTDFAKRENIQLFIKSAKHSMGLRDTQLFESQDLFESIRIRNIAITLYWLGRAARASQTYKGPQLDLLKFQGMNCSACKKAITNNDYLTTMTQQFHTSCAVCCSCSCKLDPKKKFYQESNNFWCENCMLGATNLGGSNNSSGGKNKSNNNNNNKCSGCFGSLEKGYVPDENDKEKKYCTSCICDLCHDPLIGNFQVKDGKKVCDSCSCKSCGKSLEDGYYEEGISKYCEPCAKDRNKPKQVMDKDGHDHHHHNHNKPTTTTTTTNSNSPLAKKKSDSCKMCDKPVDNKTKKYGDDRDKYCTPHEKDGTCGKCNGELVGSAISVMDKNFHPQCFKCDSCNKNLNQNDQIKKSPTTGNPLCGPCSSNNNKSSKNCHDCKKPISGSSVEALDRPYHPNCLKCYSCSKNLKEDFTEVDNEPFCNPCASQLNQYTSGNQKQPKQGGSPFITSGWLDSDRCVVCVKPLNGEVAKIFDSFYHKGCFKCTDKSCNAPLLTGYFPHDKKPYCQKCSIKIQQSTTTDHCAKCSKPIIEGSILKVAGKVYHKSCYDNEKHTSSSSSSSSVNCFKCKSQITGTQFVRLDQKDYCMKCSPSASSSTTVTHGERLNYGMTVDPRSGKRVFNTSK limf_dicdi LIM domain-containing protein F limF DDB_G0275157 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSGQNILKCKKCQLEITNKIITNHNSDTFHEQCFVCKLCSTPISDPYFTDKETGDFYCAKCEVIRNDQSKPLRESLGFCSLCYKYFRQNEDILTIDLERYHIGCLKCTICKKGINNEKYYREKMTSKLSNYCCEDCFEKVDKCNGCNSMTLGQTLLAMGKNYHANCFKCFKCSEIIKPNSPYSINKQTNTPSCQKCN rab21_dicdi Ras-related protein Rab-21 rab21 rabB Ras-related protein RabB DDB_G0286553 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTDTEKSFKVVLLGEGCVGKTSIVFRYIDNIFNDKHLMTQHAGFFQKHINIGGKRICLTIWDTAGQERFHALGPIYYRGSQGALVVYDITDNDSFIKAKNWIKELKTMLGNDISLCIIGNKCDLEKTRVIPLADAEAYAKSVGAIHYSTSAKLNKGIEELFLDLTRRMILNSSGVVIHSNTNTTGQTTNRSERIPIVPDSDSGNKQPGCCSN limf-chlim-2 764621 N/A 764624 unspecified role unspecified role prey prey n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false dicdi Dictyostelium discoideum (Slime mold) Slime mold N/A 764625 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 764626 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold association association false false false Fig 2A chlim-rab21-1 764621 N/A 764624 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 764626 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association false false false Fig 2B, 2D limf-rab21-3 764621 N/A 764625 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A-x-x 764626 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association false false false Fig 2D limf-rab21-1 764622 N/A 764625 unspecified role unspecified role bait bait N/A 764626 unspecified role unspecified role prey prey physical association physical association false false false limf-limch-1 764622 n/a 764625 unspecified role unspecified role bait bait n/a 764624 unspecified role unspecified role prey prey physical association physical association false false false limf-rab21-2 764623 N/A 764626 unspecified role unspecified role prey prey N/A 764625 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1b limf-chlim-1 764623 N/A 764625 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 764624 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1b