UniProt UniProt http://www.uniprot.org kitazawa-2005-2 Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. bovin-adrenal medulla Bos taurus adrenal medulla cells adrenal medulla anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. yamakumi@mail.pharm.tohoku.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation kitazawa-2005-1 Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. yamakumi@mail.pharm.tohoku.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation kitazawa-2005-3 Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. rat-brain-cerebellum Rattus norvegicus brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. yamakumi@mail.pharm.tohoku.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation kitazawa-2005-4 Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells. rat-brain-cerebellum Rattus norvegicus brain_cerebellum [Cerebellar] confocal microscopy confocal microscopy immunostaining immunostaining Kitazawa M., Yamakuni T., Song SY., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. yamakumi@mail.pharm.tohoku.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation mtpn_bovin Myotrophin MTPN protein protein bovin Bos taurus (Bovine) Bovine MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ capzb_bovin F-actin-capping protein subunit beta CAPZB CapZ beta protein protein bovin Bos taurus (Bovine) Bovine MHPCRRSLPFPLNCQLVKVGTADYGGASDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC capzb_rat F-actin-capping protein subunit beta Capzb CapZ beta protein protein rat Rattus norvegicus (Rat) Rat MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC mtpn_rat Myotrophin Mtpn Gcdp Protein V-1 Granule cell differentiation protein protein protein rat Rattus norvegicus (Rat) Rat MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ mtpn-capzb-1 783294 n/a 783298 unspecified role unspecified role bait bait n/a 783299 unspecified role unspecified role prey prey physical association physical association false false false DB-cAMP; treatment for 24h with 1 mM DB-cAMP stimulated the interaction. 5 mtpn-capzb-2 783294 n/a 783298 unspecified role unspecified role bait bait n/a 783299 unspecified role unspecified role prey prey physical association physical association false false false DB-cAMP; treatment for 6-24h with DB-cAMP stimulated the interaction. 4A and B forskolin; treatment for 6 to 12h stimulated the interaction; the interaction peaked for a 12h and decreased to initial levels for a 24h treatment. forskolin; treatment for 2h decreased the interaction. DB-cAMP; treatment for 2h decreased the interaction. Q3T0F7: transfection mtpn-capzb 783295 n/a 783300 unspecified role unspecified role prey prey n/a 783301 unspecified role unspecified role bait bait physical association physical association false false false P62775: transfection 2C mtpn-capzb-3 783296 n/a 783301 unspecified role unspecified role bait bait n/a 783300 unspecified role unspecified role prey prey physical association physical association false false false 3B mtpn-capzb-4 783297 n/a 783301 unspecified role unspecified role neutral component neutral component n/a 783300 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3A Co-localization was observed in the soma and primary dendrites of Purkinje cells. In postnatal 14-day-old rats, co-localization was observed in glomerular synaptic junctions in the innergranule layer as well as in the cell bodies of Purkinje cells.