IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ freire-2005-1 Translation initiation factor (iso) 4E interacts with BTF3, the beta subunit of the nascent polypeptide-associated complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Miguel Angel Freire Insufficient information was provided by the author to identify the wheat proteins used in this study and therefore interactions involving these proteins were not curated. migangfreire@hotmail.com Arabidopsis cDNA library Gene (0378-1119) 2005 freire-2005-2 Translation initiation factor (iso) 4E interacts with BTF3, the beta subunit of the nascent polypeptide-associated complex. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Miguel Angel Freire Insufficient information was provided by the author to identify the wheat proteins used in this study and therefore interactions involving these proteins were not curated. migangfreire@hotmail.com Arabidopsis cDNA library Gene (0378-1119) 2005 if4e4_arath Eukaryotic translation initiation factor isoform 4E EIF(ISO)4E LSP1 Protein LOSS OF SUSCEPTIBILITY TO POTYVIRUS 1 eIF-(iso)4F 25 kDa subunit eIF-(iso)4F p28 subunit eIF4Eiso protein mRNA cap-binding protein MJE4.8 At5g35620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATDDVNEPLPAAAELPATEAEKQPHKLERKWSFWFDNQSKKGAAWGASLRKAYTFDTVEDFWGLHETIFQTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALIGEQFDEADEICGVVASVRPQSKQDKLSLWTRTKSNEAVLMGIGKKWKEILDVTDKITFNNHDDSRRSRFTV btf3_arath Basic transcription factor 3 BTF3 Nascent polypeptide-associated complex subunit beta F2H15.11 At1g17880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNREKLMKMANTVRTGGKGTVRRKKKAVHKTNTTDDKRLQSTLKRIGVNSIPAIEEVNIFKDDVVIQFINPKVQASIAANTWVVSGSPQTKKLQDILPQIISQLGPDNMDNLKKLAEQFQKQASGEGNAASATIQEEDDDDVPELVGETFETAAEEKAPAAAASS eif4e2-btf3 EIF4E2 interacts with BTF3 734649 N/A 734651 unspecified role unspecified role bait bait N/A 734652 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false eif4e2-btf3-1 EIF4E2 interacts with BTF3 734650 N/A 734651 unspecified role unspecified role bait bait n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 734652 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 2