UniProt UniProt http://www.uniprot.org lo-2004-1 Phosphorylation by the beta-catenin/MAPK complex promotes 14-3-3-mediated nuclear export of TCF/POP-1 in signal-responsive cells in C. elegans. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lo MC., Gay F., Odom R., Shi Y., Lin R. rueyling.lin@utsouthwestern.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation lo-2004-2 Phosphorylation by the beta-catenin/MAPK complex promotes 14-3-3-mediated nuclear export of TCF/POP-1 in signal-responsive cells in C. elegans. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lo MC., Gay F., Odom R., Shi Y., Lin R. rueyling.lin@utsouthwestern.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation 14331_caeel 14-3-3-like protein 1 par-5 ftt-1 M117.2 Partitioning defective protein 5 protein protein caeel Caenorhabditis elegans MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN pop1_caeel Protein pop-1 pop-1 W10C8.2 Posterior pharynx defect protein 1 protein protein caeel Caenorhabditis elegans MMADEELGDEVKVFRRDEDADDDPMISGETSEQQLADDKKEAVMEAELDGAGRNPSIDVLKSAFPKVEPMSPSFPGLMSHFSPGYSAAALPMFMPLFMNPYAAALRSPSLMFPMGAMSPTFPMFPPSPVYGAAIAAAAAKQHFENMAPLNMRAGHPMNQMGMPPYMHPSSMAPQNVDRRAQGGGKAKKDDHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQAKYFEMAKKDKETHKERYPEWSARENYAVNKKKTKKRRDKSIPSENNDQKKCRARFGVNNTEMWCKFCKRKKKCEYATDRSGGSDITDSQDGRGTSGAYSSSSESPSPKANAGIALTTQQQQAAMMHTMLMQMRLGSTTGASTHVPSPLASSSAGRSPLDANASDSESDVEEEEDEQIDPTVMQQTHDMLMQESMCTI pop1-par5-1 765514 N/A 765516 unspecified role unspecified role prey prey N/A 765517 unspecified role unspecified role bait bait physical association physical association false false false Fig 2B pop1-par5-2 765515 N/A-x 765517 unspecified role unspecified role bait bait Q10666:p.[Ser107Ala;Ser109Ala;Ser118Ala;Thr120Ala;Ser127Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A-x 765516 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig 2E Interaction between pop-1 and par-5 may require phosphorylation of pop-1 on serine 118 and serine 127.