MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cohen-2004b-1 Protein tyrosine phosphatase 1B participates in the down-regulation of erythropoietin receptor signalling. human-bosc_23 Homo sapiens embryonic kidney cell line BOSC-23 bosc_23 Human embryonic kidney cell line BOSC-23 The BOSC-23 cell line are a derivative of the 293T cell line. pull down pull down predetermined predetermined participant predetermined Cohen J., Oren-Young L., Klingmuller U., Neumann D. Phosphatases Biochem. J. (0264-6021) 2004 partial coverage rapid curation cohen-2004b-2 Protein tyrosine phosphatase 1B participates in the down-regulation of erythropoietin receptor signalling. human-bosc_23 Homo sapiens embryonic kidney cell line BOSC-23 bosc_23 Human embryonic kidney cell line BOSC-23 The BOSC-23 cell line are a derivative of the 293T cell line. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Cohen J., Oren-Young L., Klingmuller U., Neumann D. Phosphatases Biochem. J. (0264-6021) 2004 partial coverage rapid curation cohen-2004b-3 Protein tyrosine phosphatase 1B participates in the down-regulation of erythropoietin receptor signalling. mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 Mouse pro B cell line. IL-3 dependent murine pro B cell line established from peripheral blood; apparently derived from BALB/c mouse. phosphatase assay phosphatase assay predetermined predetermined participant predetermined Cohen J., Oren-Young L., Klingmuller U., Neumann D. Phosphatases Biochem. J. (0264-6021) 2004 partial coverage rapid curation epor_human Erythropoietin receptor EPOR protein protein human Homo sapiens Human MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT ptpn1-epor 771557 epor_human EPOR 771560 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ptn1_human PTP1B 771561 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 D\A Trapping mutant form of PTP1B homomint mint ptpn1-epor-1 771558 epor_human EPOR 771560 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ptn1_human PTP1B 771561 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4 WT and D\A Trapping mutant form of PTP1B homomint mint epor-ptpn1 771559 ptn1_human PTP1B 771561 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false epor_human EPOR 771560 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed living cell living cell dephosphorylation dephosphorylation reaction dephosphorylation false false false F8 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. WT and D\A Trapping mutant form of PTP1B. homomint mint