IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ salinas-2003-1 Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es E coli libraries S0, S1 and S2 Mol. Genet. Genomics (1617-4615) 2003 Only protein-protein interactions imex curation salinas-2003-2 Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es E coli libraries S0, S1 and S2 Mol. Genet. Genomics (1617-4615) 2003 Only protein-protein interactions imex curation ntrc_ecoli DNA-binding transcriptional regulator NtrC glnG glnT ntrC b3868 JW3839 Nitrogen regulation protein NR(I) Nitrogen regulator I protein protein ecoli Escherichia coli (strain K12) MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQLENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQMQPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME ntrb_ecoli Sensory histidine kinase/phosphatase NtrB glnL glnR ntrB b3869 JW3840 Nitrogen regulation protein NR(II) Nitrogen regulator II protein protein ecoli Escherichia coli (strain K12) MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK glnb_ecoli Nitrogen regulatory protein P-II 1 glnB b2553 JW2537 protein protein ecoli Escherichia coli (strain K12) MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI glnk_ecoli Nitrogen regulatory protein GlnK ybaI glnK b0450 JW0440 Nitrogen regulatory protein P-II 2 PII-like protein protein protein ecoli Escherichia coli (strain K12) MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL aspa_ecoli Aspartate ammonia-lyase aspA b4139 JW4099 protein protein ecoli Escherichia coli (strain K12) MSNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIPEFVRGMVMVKKAAAMANKELQTIPKSVANAIIAACDEVLNNGKCMDQFPVDVYQGGAGTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGATAIGTGLNTPKEYSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKEVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFSVQNLMHPAYKAKRYTDESEQ B6E8432DBF385DEA ntrb-ntrc 770328 n/a 770330 unspecified role unspecified role bait bait n/a 770331 unspecified role unspecified role prey prey physical association physical association false false false 1 ntrb-ntrc-1 770328 n/a 770330 unspecified role unspecified role prey prey n/a 770331 unspecified role unspecified role bait bait physical association physical association false false false 1 ntrc-ntrc 770328 n/a 770330 unspecified role unspecified role bait bait n/a 770330 unspecified role unspecified role prey prey physical association physical association false false false 1 ntrb-glnb 770328 n/a 770332 unspecified role unspecified role bait bait n/a 770331 unspecified role unspecified role prey prey physical association physical association false false false 1 ntrb-glnb-1 770328 n/a 770331 unspecified role unspecified role bait bait n/a 770332 unspecified role unspecified role prey prey physical association physical association false false false 1 ntrb-ntrb-3 770328 n/a 770331 unspecified role unspecified role bait bait n/a 770331 unspecified role unspecified role prey prey physical association physical association false false false 1 homodimerisation shown glnk-ntrb-3 770329 n/a 770333 unspecified role unspecified role prey prey n/a 770331 unspecified role unspecified role bait bait physical association physical association false false false 3A,B glnk-ntrb-4 770329 n/a 770333 unspecified role unspecified role bait bait n/a 770331 unspecified role unspecified role prey prey physical association physical association false false false 3A,B aspa-ntrb 770329 n/a 770334 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 770331 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3A,B aspa-ntrb-1 770329 n/a 770334 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 770331 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3A,B