IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lara-2003-2 Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Lara P., Onate-Sanchez L., Abraham Z., Ferrandiz C., Diaz I., Carbonero P., Vicente-Carbajosa J. Assays were carried out at 23C and 30C. jvicente@bit.etsia.upm.es. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation lara-2003-1 Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lara P., Onate-Sanchez L., Abraham Z., Ferrandiz C., Diaz I., Carbonero P., Vicente-Carbajosa J. Assays were carried out at 23C and 30C. jvicente@bit.etsia.upm.es. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation bzp25_arath Basic leucine zipper 25 BZIP25 BZO2H4 Basic leucine zipper OPAQUE 2 homolog 4 T14E10.190 At3g54620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHIVFSVDDLTESFWPVPAPAPSPGSSSTPSPTQNVADGMTRSQSEWAFHRLINELSGSDSSPTTNTIERSPPPVQSLSRLEETVDETEDVVEIQKPQNHRRLPVDDQGKNRNRAPSSDPVDSSAPVVVDPNQYHAILKSKLELACAAVARRVGTVKPEDSSASASNQKQAQGSIVAQTSPGASSVRFSPTTSTQKKPDVPARQTSISSRDDSDDDDLDGDADNGDPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIPFSNTPSASSSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAPDSNLYETLPHWNHKH at2s1-arath-dna At2S1 promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TTCTTACACGTGAACTC cru3-arath-dna CRU3 promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TAATCCTACGTGGCTCA bzp10_arath Basic leucine zipper 10 BZIP10 BZO2H1 Basic leucine zipper OPAQUE 2 homolog 1 T10P11.9 At4g02640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD op2_maize Regulatory protein opaque-2 O2 protein protein maize Zea mays (Maize) Maize MEHVISMEEILGPFWELLPPPAPEPEREQPPVTGIVVGSVIDVAAAGHGDGDMMDQQHATEWTFERLLEEEALTTSTPPPVVVVPNSCCSGALNADRPPVMEEAVTMAPAAVSSAVVGDPMEYNAILRRKLEEDLEAFKMWRADSSVVTSDQRSQGSNNHTGGSSIRNNPVQNKLMNGEDPINNNHAQTAGLGVRLATSSSSRDPSPSDEDMDGEVEILGFKMPTEERVRKKESNRESARRSRYRKAAHLKELEDQVAQLKAENSCLLRRIAALNQKYNDANVDNRVLRADMETLRAKVKMGEDSLKRVIEMSSSVPSSMPISAPTPSSDAPVPPPPIRDSIVGYFSATAADDDASVGNGFLRLQAHQEPASMVVGGTLSATEMNRVAAATHCAGAMELIQTAMGSMPPTSASGSTPPPQIMSCWVQMGPYTWTCIRHCGFRDRWEHFICRRR abi3_arath B3 domain-containing transcription factor ABI3 ABI3 MSD24.2 At3g24650 Protein ABSCISIC ACID-INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQQAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK at3g54620-dna AT3G54620 binds the AtS1 promoter region 695505 N/A 695507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 695508 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at3g54620-dna-1 AT3G54620 binds the CRU3 promoter region 695505 N/A 695507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 695509 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at4g02640-dna-2 AT4G02640 binds the CRU3 promoter region 695505 N/A 695510 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 695509 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at4g02640-dna-3 AT4G02640 binds the AtS1 promoter region 695505 N/A 695510 unspecified role unspecified role neutral component neutral component N/A 695508 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B and Figure 4C Mutation of the ACGT sequence to AAGG abolished interaction. The presence of the ABI3 (Q01593) protein stimulated protein binding to DNA It is not clear from the text if recombinant or in vitro synthesised proteins were used o2-dna-4 Opaque2 binds the AtS1 promoter region 695505 N/A 695508 unspecified role unspecified role neutral component neutral component N/A 695511 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4C The presence of the ABI3 (Q01593) protein increased protein binding to DNA It is not clear from the text if recombinant or in vitro synthesised proteins were used. at4g02640-abi3 Interaction between At4g02640 and ABI3 695506 N/A 695512 unspecified role unspecified role prey prey n terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 695510 unspecified role unspecified role bait bait n terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B at3g54620-abi3-1 Interaction between At3g54620 and ABI3 695506 N/A 695512 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 695507 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B Interactions between AtbZIP25 and ABI3 could not be reliably reproduced at 30 C, but lowering incubation temperatures to 23 C resulted in consistent data in all replicated experiments. From Figure 5B it would seem that both N and C terminal regions of AtZIP25 interact with ABI3.