IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yahalom-2001-1 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-2 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-3 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-4 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. arath-leaf Arabidopsis thaliana leaf leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-5 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-6 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 yahalom-2001-7 Arabidopsis eIF3e (INT-6) associates with both eIF3c and the COP9 signalosome subunit CSN7. braob Brassica oleracea var. botrytis (Cauliflower) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Yahalom A., Kim TH., Winter E., Karniol B., von Arnim AG., Chamovitz DA. The authors note that "it must be pointed out that all immunoprecipitates were washed with RIPA buffer, conditions that would not allow identification of weak interactions". chamd@post.tau.ac.il J. Biol. Chem. (0021-9258) 2001 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH eif3c_arath Eukaryotic translation initiation factor 3 subunit C TIF3C1 F18O21_110 At3g56150 eIF3 p110 p105 Eukaryotic translation initiation factor 3 subunit 8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSRFFTQVGSESEDESDYEVEVNEVQNDDVNNRYLQSGSEDDDDTDTKRVVKPAKDKRFEEMTYTVDQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEAVKPPTLYIKTLVMLEDFLNEALANKEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDINKYREAPEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGSDVDEPTDNLTWEKMLSKKDKLLEKLMNKDPKEITWDWVNKKFKEIVAARGKKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPINVWKKCVLNMLTILDILVKYSNIVVDDTVEPDENETSKPTDYDGKIRVWGNLVAFLERVDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYFERMGDFKAAAKVALRRVEAIYYKPQEVYDAMRKLAELVEEEEETEEAKEESGPPTSFIVVPEVVPRKPTFPESSRAMMDILVSLIYRNGDERTKARAMLCDINHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGLCAFRAGMITESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLNLELLEAVHLICAMLLEVPNMAANSHDAKRRVISKNFRRLLEISERQAFTAPPENVRDHVMAATRALTKGDFQKAFEVLNSLEVWRLLKNRDSILDMVKDRIKEEALRTYLFTYSSSYESLSLDQLAKMFDVSEPQVHSIVSKMMINEELHASWDQPTRCIVFHEVQHSRLQSLAFQLTEKLSILAESNERAMESRTGGGGLDLSSRRRDNNQDYAGAASGGGGYWQDKANYGQGRQGNRSGYGGGRSSGQNGQWSGQNRGGGYAGRVGSGNRGMQMDGSSRMVSLNRGVRT csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL eif3e_arath Eukaryotic translation initiation factor 3 subunit E TIF3E1 Eukaryotic translation initiation factor 3 subunit 6 INT6 F28O9.140 At3g57290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEESKQNYDLTPLIAPNLDRHLVFPIFEFLQERQLYPDEQILKSKIQLLNQTNMVDYAMDIHKSLYHTEDAPQEMVERRTEVVARLKSLEEAAAPLVSFLLNPNAVQELRADKQYNLQMLKERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIALEELNRLKEIIDSKSFSSPLNQVQNRIWLMHWGLYIFFNHDNGRTQIIDLFNQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVFVNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFVFETYCKIHQRIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTKGLSGRTYKLVNQLLEHTQAQATR q9m4t6_arath Eukaryotic translation initiation factor 3 subunit B eIF-3-eta eIF3 p110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAVVDIDVLTAQLGINWSDVNLDSIQLPPGNDFGIESDDESVYQDDQSEFDTGFGNIIVVDHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLLMPVDPDTKMTLGYCFIEFNTPQEAQNAKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQERPYVPGENLQKWLTDDKARDQLVIRFGHDTEVYWNDARQKKPEPVHKRSYWTESYVQWSPIGTYLVTLHKQGAAVWGGADTFTRLMRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVRTGRMMRDFKGSADEFSIGGPGGVAGASWPVFRWACGKDDKYFAKLSKNTISVYETETFSLIDKKSMKVDNVVDICWSPTDSILSLFVPEQGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQSSGEYLAVKVDRYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGQRFAGIHGDQPNRDVSFYSIKTGTKTLERVSKLATLKAKQAKCPLLVAPQASTSFLAGLKGFNGQLEFFNVDELETMATAEHFMATDIEWDPTGRYVATSVTTVHEMENGFTIWSFNGNMVYRILKDHFFQLAWRPRPASFLTAEKEEEIAKNLRNYSKRYEAEDQDVSLLLSEQDREKRRALNEEWQKWVMQWKSLHEEEKLVRQNLRDGEVSDVEEDEYEAKEVEFEDLIDVTEEIVQELM csn7_arath COP9 signalosome complex subunit 7 Protein FUSCA 5 FUS5 At1g02090 T7I23.24 T7I23.25 CSN7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR eif3b-braob-pro Eif3b protein Cauliflower protein protein braob Brassica oleracea var. botrytis (Cauliflower) An amino acid sequence which is not represented in UniProt This protein is a homologue of Eif3b in arabidopsis csn7-braob-pro CSN7 protein Cauliflower protein protein braob Brassica oleracea var. botrytis (Cauliflower) An amino acid sequence which is not represented in UniProt Homologue sof CSN7 protein in arabidopsis eif3e-braob-pro Eif3e protein Cauliflower protein protein braob Brassica oleracea var. botrytis (Cauliflower) An amino acid sequence which is not represented in UniProt Homologue of Eif3e protein in arabidopsis csn8-eif3c Interaction between CSN8 and EIF3c proteins 723848 N/A 723855 unspecified role unspecified role bait bait N/A 723856 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A csn1-eif3c Interaction between CSN1 and EIF3c proteins 723848 N/A 723856 unspecified role unspecified role prey prey N/A 723857 unspecified role unspecified role bait bait physical association physical association false false false Figure 1A eif3-eif3c Interaction between EIF3 and EIF3c proteins 723848 N/A 723858 unspecified role unspecified role bait bait N/A 723856 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A eif3b-eif3c Interaction between EIF3b and EIF3c proteins 723848 N/A 723856 unspecified role unspecified role prey prey N/A 723859 unspecified role unspecified role bait bait physical association physical association false false false Figure 1A eif3-csn7 Interaction between EIF3 and CSN7 723848 N/A 723860 unspecified role unspecified role prey prey N/A 723858 unspecified role unspecified role bait bait physical association physical association false false false Figure 1B The eIF3e protein coimmunoprecipitated a core component of the COP9 signalosome, CSN7, in extracts from both wild type and cop9 mutants, eif3-csn7-1 Interaction between EIF3 and CSN7 723849 N/A 723858 unspecified role unspecified role prey prey N/A 723860 unspecified role unspecified role bait bait physical association physical association false false false Figure 2A eif3-eif3c-1 Interaction between EIF3 and EIF3c proteins 723849 N/A 723856 unspecified role unspecified role bait bait N/A 723858 unspecified role unspecified role prey prey physical association physical association false false false Figure 2A eif3c-eif3b Interaction between EIF3c and EIF3b proteins 723849 N/A 723856 unspecified role unspecified role prey prey N/A 723859 unspecified role unspecified role bait bait physical association physical association false false false Figure 2B eif3-eif3c-2 Interaction between EIF3 and EIF3c proteins 723850 N/A 723856 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 723858 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 3B csn7-eif3 Interaction between CSN7 and EIF3 723850 N/A 723860 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 723858 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3A eif3-csn7-2 Colocalisation of EIF3 and CSN7 723851 N/A 723858 unspecified role unspecified role neutral component neutral component N/A 723860 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 5 The localization of eIF3e overlapped that of the CSN7 protein, which was found in both nucleus and cytoplasm of root and leaf protoplasts eif3-csn7-3 Colocalisation of EIF3 and CSN7 723852 N/A 723860 unspecified role unspecified role neutral component neutral component N/A 723858 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 5 The localization of eIF3e overlapped that of the CSN7 protein, which was found in both nucleus and cytoplasm of root and leaf protoplasts eif3-csn7-eif3b Interaction between EIF3 , CSN7 and EIF3b 723853 N/A 723858 unspecified role unspecified role neutral component neutral component N/A 723859 unspecified role unspecified role neutral component neutral component N/A 723860 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 6 eif3-csn7-eif3b-1 Interaction between EIF3 , CSN7 and EIF3b 723854 N/A 723861 unspecified role unspecified role neutral component neutral component N/A 723862 unspecified role unspecified role neutral component neutral component N/A 723863 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 6