IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ correa_bord-1997-1 p25rum1 promotes proteolysis of the mitotic B-cyclin p56cdc13 during G1 of the fission yeast cell cycle. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Correa-Bordes J., Gulli MP., Nurse P. nurse@icrf.icnet.uk EMBO J. (0261-4189) 1997 correa_bord-1997-2 p25rum1 promotes proteolysis of the mitotic B-cyclin p56cdc13 during G1 of the fission yeast cell cycle. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Correa-Bordes J., Gulli MP., Nurse P. nurse@icrf.icnet.uk EMBO J. (0261-4189) 1997 rum1_schpo Cyclin-dependent kinase inhibitor rum1 rum1 SPBC32F12.09 p25-rum1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPSTPPMRGLCTPSTPESPGSFKGVIDASLEGNSSIMIDEIPESDLPAPQVSTFPPTPAKTPKKQLLPNLMLQDRSNSLERCMEEDREHNPFLSSSDNQLLSRKKRKPTPPPSDGLYYVFRGKRIKKSFRPGTDLSTFKPKLLFADSAPSSSSDNPTSSVDLNDYSQIGILPPNLNSIGNKMFSLKSRVPSSSSGSFVAPPPQMRLPAYSSPQKSRSNTKDENRHNLLR cg23_schpo G2/mitotic-specific cyclin cdc13 cdc13 SPBC582.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTRRLTRQHLLANTLGNNDENHPSNHIARAKSSLHSSENSLVNGKKATVSSTNVPKKRHALDDVSNFHNKEGVPLASKNTNVRHTTASVSTRRALEEKSIIPATDDEPASKKRRQPSVFNSSVPSLPQHLSTKSHSVSTHGVDAFHKDQATIPKKLKKDVDERVVSKDIPKLHRDSVESPESQDWDDLDAEDWADPLMVSEYVVDIFEYLNELEIETMPSPTYMDRQKELAWKMRGILTDWLIEVHSRFRLLPETLFLAVNIIDRFLSLRVCSLNKLQLVGIAALFIASKYEEVMCPSVQNFVYMADGGYDEEEILQAERYILRVLEFNLAYPNPMNFLRRISKADFYDIQTRTVAKYLVEIGLLDHKLLPYPPSQQCAAAMYLAREMLGRGPWNRNLVHYSGYEEYQLISVVKKMINYLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKNSIPLGDDADEDYTFHKQKRIQHDMKDEEW B2C267CF57F5FD36 cdk1_schpo Cyclin-dependent kinase 1 cdc2 swo2 SPBC11B10.09 pi002 p34 protein kinase cdk1 Cell division control protein 2 Cell division protein kinase 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MENYQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIRLEDESEGVPSTAIREISLLKEVNDENNRSNCVRLLDILHAESKLYLVFEFLDMDLKKYMDRISETGATSLDPRLVQKFTYQLVNGVNFCHSRRIIHRDLKPQNLLIDKEGNLKLADFGLARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGVDIWSVGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGTPNEEVWPGVTLLQDYKSTFPRWKRMDLHKVVPNGEEDAIELLSAMLVYDPAHRISAKRALQQNYLRDFH cdc13-rum1-3 CoIP showing interaction between cdc13 and rum1 597613 N/A 597615 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 597616 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 597617 unspecified role unspecified role ancillary ancillary region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 4. Shows that rum1 can specifically associate with cdc13 alone or complexed with cdc2 in vitro. cdc13-rum1-4 CoIP showing interaction between cdc13 and rum1 597613 N/A 597615 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 597616 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 4. Shows that rum1 can specifically associate with cdc13 alone or complexed with cdc2 in vitro. Also deletion of the destruction box in the cdc13-delta-90 mutant did not inhibit its binding with rum1. cdc2-rum1-1 Protein kinase assay showing rum1 as a substrate for cdc2 . 597614 N/A 597615 enzyme target enzyme target substrate substrate unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 597617 enzyme enzyme unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 8. Rum1 kinase activity was detected with both anti-cdc2 and anti-cig1 antibodies. However, cig1 had been immunoprecipitated using cdc2, the authors state that the kinase activity it due to the formation a cig/cdc2 complex which phosphorylates rum1. Phosphorylation of Rum1