UniProt UniProt http://www.uniprot.org duina-1996-1 Identification of two CyP-40-like cyclophilins in Saccharomyces cerevisiae, one of which is required for normal growth. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Duina AA., Marsh JA., Gaber RF. r-gaber@nwu.edu Yeast (0749-503X) 1996 duina-1996-2 Identification of two CyP-40-like cyclophilins in Saccharomyces cerevisiae, one of which is required for normal growth. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Duina AA., Marsh JA., Gaber RF. r-gaber@nwu.edu Yeast (0749-503X) 1996 rpd3_yeast Histone deacetylase RPD3 RPD3 SDI2 YNL330C N0305 MOF6 REC3 SDS6 Transcriptional regulatory protein RPD3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQYARDLHVEHDNEFY 34FFD72A7E7425DB ppid_yeast Peptidyl-prolyl cis-trans isomerase CPR6 CPR6 YLR216C L8167.24 Rotamase CPR6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTRPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQVPENAEATPTDEYGDNYEDVLKQDEKVDLKNFDTVLKAIETVKNIGTEQFKKQNYSVALEKYVKCDKFLKEYFPEDLEKEQIEKINQLKVSIPLNIAICALKLKDYKQVLVASSEVLYAEAADEKAKAKALYRRGLAYYHVNDTDMALNDLEMATTFQPNDAAILKAIHNTKLKRKQQNEKAKKSLSKMFS 188666D94866DDDD cyp7_yeast Peptidyl-prolyl cis-trans isomerase CYP7 CPR7 YJR032W J1585 Rotamase CYP7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIQDPLVYLDISIDKKPIGRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGNGFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENLGEFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVDSDGVPESDVRISDCGVWEKTMGVPLYNASNDQIGGDVYEEYPDDDTHFGDDDFGKALEAANIIKESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSLVLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDEALQDYIFCKEKNPDDEVIEQRIEYVNRLIEENKEKTRKNISKFFS 1532F255E8016F4F rpd3-cpr6 682674 N/A 682676 unspecified role unspecified role bait bait N/A 682677 unspecified role unspecified role prey prey physical association physical association false false false rpd3-cpr7 682674 N/A 682676 unspecified role unspecified role bait bait N/A 682678 unspecified role unspecified role prey prey physical association physical association false false false cpr6-rpd3 682675 N/A 682676 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 682677 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2B cpr7-rpd3 682675 N/A 682678 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 682676 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2B