IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vignard-2007-1 The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. peter.schloegelhofer@univie.ac.at PLoS Genet. (1553-7390) 2007 Only protein-protein interactions imex curation vignard-2007-2 The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. arath-pollen Arabidopsis thaliana pollen Pollen In plants the male structure that contains sperm capable of fertilizing eggs. Pollen is derived from the anther of the flower. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. Meiocyte spreads were made from arabidopsis pollen and used in immunostaining studies reported here. Identification for ASY1 was made from reference PMID 12186950 . peter.schloegelhofer@univie.ac.at PLoS Genet. (1553-7390) 2007 Only protein-protein interactions imex curation mnd1_arath Meiotic nuclear division protein 1 homolog MND1 Meiotic nuclear division 1-like protein F19B15.200 At4g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA ahp2_arath Histidine-containing phosphotransfer protein 2 AHP2 ATHP1 At3g29350 MUO10.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN dmc1_arath Meiotic recombination protein DMC1 homolog DMC1 LIM15 F5N5.6 At3g22880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLKAEETSQMQLVEREENDEDEDLFEMIDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYMTGSDALIKRKSVVKITTGCQALDDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRILIVDSIIALFRVDFTGRGELADRQQKLAQMLSRLIKIAEEFNVAVYMTNQVIADPGGGMFISDPKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVYDAPNLAEAEASFQITQGGIADAKD rad51_arath DNA repair protein RAD51 homolog 1 RAD51 Rad51-like protein 1 At5g20850 F22D1.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTMEQRRNQNAVQQQDDEETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAYTPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALLIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAHATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD asy1_arath Meiosis-specific protein ASY1 At1g67370/At1g67380 ASY1 Protein ASYNAPTIC 1 F1N21.19/F1N21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVMAQKLKEAEITEQDSLLLTRNLLRIAIFNISYIRGLFPEKYFNDKSVPALDMKIKKLMPMDAESRRLIDWMEKGVYDALQRKYLKTLMFSICETVDGPMIEEYSFSFSYSDSDSQDVMMNINRTGNKKNGGIFNSTADITPNQMRSSACKMVRTLVQLMRTLDKMPDERTIVMKLLYYDDVTPPDYEPPFFRGCTEDEAQYVWTKNPLRMEIGNVNSKHLVLTLKVKSVLDPCEDENDDMQDDGKSIGPDSVHDDQPSDSDSEISQTQENQFIVAPVEKQDDDDGEVDEDDNTQDPAENEQQLARVKDWINSRHLDTLELTDILANFPDISIVLSEEIMDQLVTEGVLSKTGKDMYIKKRDKTPESEFTFVKEEADGQISPGKSVAPEDYLYMKALYHSLPMKYVTITKLHNMLDGEANQTAVRKLMDRMTQEGYVEASSNRRLGKRVIHSSLTEKKLNEVRKVLATDDMDVDVTETINKTNGPDAKVTADVSTCGGIHSIGSDFTRTKGRSGGMQQNGSVLSEQTISKAGNTPISNKAQPAASRESFAVHGGAVKEAETVNCSQASQDRRGRKTSMVREPILQYSKRQKSQAN ahp2-mnd1 Interaction between AHP2 and MND1 678718 N/A 678720 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678721 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9 mnd1-ahp2 Interaction between MND1 and AHP2 678718 N/A 678720 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678721 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9 mnd1-mnd1 MND1 homodimer 678718 N/A 678720 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678720 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 9 ahp2-dmc1 Interaction between AHP2 and DMC1 678718 N/A 678722 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678721 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9 dmc1-mnd1 Interaction between DMC1 and MND1 678718 N/A 678722 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678720 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 9 dmc1-ahp2 Interaction between DMC1 and AHP2 678718 N/A 678722 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678721 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9 mnd1-dmc1 Interaction between MND1 and DMC1 678718 N/A 678720 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678722 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 9 ahp2-rad51 Interaction between AHP2 and RAD51 678718 N/A 678723 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678721 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9 mnd1-rad51 Interaction between MND1 and RAD51 678718 N/A 678720 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678723 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 9 rad51-mnd1 Interaction between RAD51 and MND1 678718 N/A 678723 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 678720 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 9 asy1-mnd1 Colocalisation of ASY1 and MND1 678719 N/A 678724 unspecified role unspecified role neutral component neutral component N/A 678720 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3, 4 The authors state that "As meiosis progressed and the ASY1 signal extended all along the axial element, AtMND1 was detected along the entire length of the chromosome, in both unsynapsed and synapsed chromosome regions. The MND1 labeling was thicker than the one for ASY1, for which the signal was detected exclusively along the axis of the chromosomes. Thus, in clear contrast to ASY1, AtMND1 was localized to both chromosome axes and loop regions. Regions of lower and higher intensity of AtMND1 signal were detected, the higher-intensity regions resembling foci". asy1-dmc1 Colocalisation of ASY1 and DMC1 678719 N/A 678724 unspecified role unspecified role neutral component neutral component N/A 678722 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 8 AtDMC1 foci are localized on the chromosome axes, as revealed by the ASY1 signal.The number of AtDMC1 foci was maximal during zygotene.