MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lygren-2007-3 AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum. in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Lygren B., Carlson CR., Santamaria K., Lissandron V., McSorley T., Litzenberg J., Lorenz D., Wiesner B., Rosenthal W., Zaccolo M., Taskén K., Klussmann E. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation lygren-2007-4 AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lygren B., Carlson CR., Santamaria K., Lissandron V., McSorley T., Litzenberg J., Lorenz D., Wiesner B., Rosenthal W., Zaccolo M., Taskén K., Klussmann E. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation lygren-2007-1 AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum. rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lygren B., Carlson CR., Santamaria K., Lissandron V., McSorley T., Litzenberg J., Lorenz D., Wiesner B., Rosenthal W., Zaccolo M., Taskén K., Klussmann E. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation lygren-2007-2 AKAP complex regulates Ca2+ re-uptake into heart sarcoplasmic reticulum. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lygren B., Carlson CR., Santamaria K., Lissandron V., McSorley T., Litzenberg J., Lorenz D., Wiesner B., Rosenthal W., Zaccolo M., Taskén K., Klussmann E. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation ppla_rat Cardiac phospholamban Pln protein protein rat Rattus norvegicus (Rat) Rat MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL mint Phospholamban has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum aka7g_rat A-kinase anchor protein 7 isoforms delta and gamma Akap7 A-kinase anchor protein 18 AKAP-18 Akap18 Protein kinase A-anchoring protein 7 isoforms delta and gamma protein protein rat Rattus norvegicus (Rat) Rat MERPAAGEIDANKCDHLSRGEEGTGDLETSPVGSLADLPFAAVDIQDDCGLPDVPQGNVPQGNPKRSKENRGDRNDHVKKRKKAKKDYQPNYFLSIPITNKKITAGIKVLQNSILRQDNRLTKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQGQVGFVKLADGDHVSALLEIAETAKRTFQEKGILAGESRTFKPHLTFMKLSKAPMLWKKGVRKIEPGLYEQFIDHRFGEEILYQIDLCSMLKKKQSNGYYHCESSIVIGEKDRKEPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSVKAEEGDRNGDGSDNNRK pln-akap7 681212 ppla_rat 681216 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false q6jp77_rat 681217 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3D Interaction is distroyed whe PLN ser16 is phosphorylated. mint pln-akap7-1 681212 ppla_rat 681216 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false q6jp77_rat 681217 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false SF2 When PLN residues R13, R14 and R21 are mutated, interaction is almost abolished. mint pln-akap7-2 681213 ppla_rat 681216 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6jp77_rat 681217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false F3C mint pln-akap7-3 681213 ppla_rat 681216 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6jp77_rat 681217 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false SF3 mint akap7-pln 681214 ppla_rat 681216 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q6jp77_rat 681217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3b mint akap7-pln-1 681215 ppla_rat 681216 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6jp77_rat 681217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false F3C mint