IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ iwai-2007-3 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-6 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-2 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-7 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. Identity of Cdh1 and Cdc20 supplied by author sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-8 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. Identity of Cdh1 and Cdc20 supplied by author sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-1 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-4 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. HeLa cells were infected a Shigella strain which expressed IpaBFLAG from an endogenous 220 kb plasmid and carried deltadapB so that intracellular Shigella would not kill the host cells in medium depleted of diaminopimelic acids. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation iwai-2007-5 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Hela cell cDNA Cell (0092-8674) 2007 Only protein-protein interactions 15 imex curation md2l2_human Mitotic spindle assembly checkpoint protein MAD2B MAD2L2 MAD2B REV7 Mitotic arrest deficient 2-like protein 2 REV7 homolog protein protein human Homo sapiens Human MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS ipab_shifl Invasin IpaB 62 kDa antigen ipaB CP0128 protein protein shifl Shigella flexneri MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF fbx5_human F-box only protein 5 FBXO5 EMI1 FBX5 Early mitotic inhibitor 1 protein protein human Homo sapiens Human MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRRL ipgc_shifl Chaperone protein IpgC ipgC ippI CP0129 protein protein shifl Shigella flexneri MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR ipab-mad2l2-3 Interaction between Shigella flexneri IpaB and human MAD2L2 by pulldown 668450 N/A 668458 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668459 unspecified role unspecified role prey prey physical association physical association false false false 1B ipab-mad2l2-4 Interaction between Shigella flexneri IpaB and human MAD2L2 by pulldown 668450 N/A 668459 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 668458 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B ipab-mad2l2-7 Interaction between Shigella flexneri IpaB and human MAD2L2 by pulldown 668450 N/A 668459 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P18011:p.Asn61Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 668458 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 668480 668476 physical association physical association false false false 1B, Supp 5C and Supp 6B mad2l2-cdc27-1 Interaction between MAD2L2 and CDC27 (APC3) identified by coimmunoprecipitation 668451 N/A 668460 unspecified role unspecified role prey prey N/A 668458 unspecified role unspecified role bait bait physical association physical association false false false Fig. Supp. 3A & 3B mad2l2-cdc27-2 Interaction between MAD2L2 and CDC27 (APC3) identified by coimmunoprecipitation 668451 N/A 668458 unspecified role unspecified role prey prey N/A 668460 unspecified role unspecified role bait bait physical association physical association false false false Fig. Supp. 3A emi1-cdc27-1 Interaction between EMI1 and CDC27 (APC3) identified by coimmunoprecipitation 668451 N/A 668460 unspecified role unspecified role bait bait N/A 668461 unspecified role unspecified role prey prey physical association physical association false false false Fig. Supp. 3A & 3B ipab-mad2l2-2 Interaction between Shigella flexneri IpaB and human MAD2L2 in Y2H 668452 N/A 668459 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false N/A 668458 unspecified role unspecified role prey prey physical association physical association false false false 1A & Supp S5A & 5B ipab-ipac-1 Interaction between Shigella flexneri IpaB and IpgCin Y2H 668452 N/A 668459 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P18011:p.Leu67Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 668462 unspecified role unspecified role prey prey physical association physical association false false false 1A * Supp S5A & 5B mad2l2-cdc20-1 Interaction between MAD2L2 and CDC20 identified by coimmunoprecipitation 668453 N/A 668463 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668458 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A mad2l2-fzr-1 Interaction between MAD2L2 and FZR (CDH1) identified by coimmunoprecipitation 668453 N/A 668464 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668458 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A mad2l2-fzr-2 Interaction between MAD2L2 and FZR (CDH1) identified by pulldown 668454 N/A 668458 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668464 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 5B & 5C When Cdh1 was pulled down after incubation with MBP-Mad2L2 in the presence of IpaB1-312WT the amounts of 3Cdh1 bound to MBP-Mad2L2 decreased as the amounts of IpaB1-312WT increased mad2l2-cdc20-2 Interaction between MAD2L2 and CDC20 identified by pulldown 668454 N/A 668463 unspecified role unspecified role prey prey in vitro In vitro N/A 668458 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B & 5C When Cdc20 was pulled down after incubation with MBP-Mad2L2 in the presence of IpaB1-312WT , the amounts of Cdc20 bound to MBP-Mad2L2 decreased as the amounts of IpaB1-312WT increased. ipab-mad2l2-1 Interaction between Shigella flexneri IpaB and human MAD2L2 in Y2H 668455 N/A 668459 unspecified role unspecified role bait bait N/A 668458 unspecified role unspecified role prey prey physical association physical association false false false ipab-mad2l2-5 Interaction between Shigella flexneri IpaB and human MAD2L2 by pulldown 668456 N/A 668459 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668458 unspecified role unspecified role prey prey physical association physical association false false false 1C ipab-mad2l2-6 Colocalization of Shigella flexneri IpaB and human MAD2L2 668457 N/A 668459 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 668458 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2