MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nishiwaki-2007-1 A sequential program of dual phosphorylation of KaiC as a basis for circadian rhythm in cyanobacteria. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nishiwaki T., Satomi Y., Kitayama Y., Terauchi K., Kiyohara R., Takao T., Kondo T. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation kaib_theeb Circadian clock protein KaiB kaiB tlr0482 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE BC6B71EFBE6254E3 mint Component of the kaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The kaiABC complex may act as a promoter-non-specific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it decreases the phosphorylation status of kaiC. It has no effect on kaiC by itself, but instead needs the presence of both kaiA and kaiC, suggesting that it acts by antagonizing the interaction between kaiA and kaiC kaic_theeb Circadian clock protein kinase KaiC tlr0483 kaiC protein protein theeb Thermosynechococcus elongatus (strain BP-1) MTNLPEHQSSPTEQSSAEVKKIPTMIEGFDDISHGGLPQGRTTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGINIFPLGAMRLTQRSSNVRVSSGVKTLDEMCGGGFFKDSIILATGATGTGKTLLVSKFLETGCQQGERALLFAYEESRAQLSRNASSWGIDFEELERRGLLRIICAYPESAGLEDHLQIIKSEIADFKPSRVAIDSLSALARGVSNNAFRQFVIGVTGFAKQEEITGFFTNTTDQFMGSNSITESHISTITDTILLLQYVEIRGEMSRAINVFKMRGSWHDKGIREYVITEKGAEIRDSFRNFEGIISGTPTRISVDEKTELARIAKGMQDLESE 34E4CDF9DE9C1824 kaia_theeb Circadian clock protein KaiA kaiA tlr0481 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAQSTALTICGLVYSPAIGQELVRLHTSDIDELVYFSSEREFCNYLEARRNSIACLILEWGEGTPQIITYLHHSATLLPAILIFPAAPAPPPAGPHYHIAEVILTTDQLDQLNRQIEEAITGFVKLCPGCAVPPHVLFRLPALKESSNVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV D3B0DCBE8A580B4E kaic-kaib-3 680157 kaib_synel kaiB 680158 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified kaic_synel kaiC 680159 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q79V60:p.Thr432Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3a f3c mint kaic-kaib-4 680157 kaib_synel kaiB 680158 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified kaic_synel kaiC 680159 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3a f3c mint kaic-kaia-8 680157 kaic_synel kaiC 680159 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q79V60:p.Thr432Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false kaia_synel kaiB kaiA 680160 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f3a f3c Binding occurs only in presence of KaiB mint kaic-kaia-9 680157 kaic_synel kaiC 680159 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false kaia_synel kaiB kaiA 680160 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f3a f3c Binding occurs only in presence of KaiB mint