MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ng-2007-2 C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ng-2007-1 C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ng-2007-3 C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ng-2007-4 C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation a1kyq1_carro protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda MYNTVKILSILTFFALTQADVHHHTACNTVGSLKGIVDSVTELVDLARERISTLEDVFSTTTLQQTFPPIVNDKQNRSFQQSLYVTQTTEQKPPLPEDCASIYQQQLNRTSGVYSIQPRFLNQSIYVFRDMETSGGGWTLIQRRGDFGKPFENFYRSWVEYKNGFGNLTQEFWLGNDIIFSLTNQDNMVLRVDLEDFKGSRRYAEYDEFLVRSERELYKMSYKTYKGDAGNSLAHHNNMMFSTKDKDNDNYKDSCAQTYKGGWWKCK fragmentation type: fragment mint q2ts39_carro Pentaxin Pentraxin CRP-1 protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda KVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKLHRLKGTPHIFSYANSETDNEILTSLNEQNDFLFNIHGKTQLNVQCNNKIHAGRWHHVCHTWSSWEGEATTAVDGFRCKGNATGKAMGVTFRQGGLVVLGQDQDSVGGGFDAKQSLVGELSELNLWDMVLNHEQIKHLSECVHPSERHIYGNVIHWDKTQFQAYDGVALSPNEICA fragmentation type: fragment mint q2ts30_carro GBP protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda MKNIMYFSLVMLLLTFLVVSPTLAEWTHINGKLSHLTVTPRFVWGVNNVHDIFRCTRPCTGSNWIKVEGSLKQIDADDHEVWGVNSNDNIYKRPVDGTGSWTQIKGGLKHVSASGYGYIWGVSSKDQIFKCPKPCNGEWELVDGSLKQVDGGRDLVYGVNQNDEIYRRPVDGSGVWENIPGKLKHISGSGSWEVFGVNCNDQIFRCKKPCSGQWVRLPGHLKQCDASGDSLMGVNSNDDIFESVPASKSCWLNPFL mint fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA gbp-a1kyq1 679514 a1kyq1_carro CL5 679518 predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level q2ts39_carro CRP 679519 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level q2ts30_carro GBP 679520 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified association association false false false Only when hemolymph is infected. f3b mint crp-fcn2 679514 fcn2_human CL5 L-Ficolin 679521 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified crp_human CRP 679522 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false f4a homomint mint crp_1-fcn1 679514 q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified fcn1_human M-Ficolin 679523 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4b mint fcn1-crp_1 679514 q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified fcn1_human M-Ficolin 679523 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4d mint crp_1-gbp 679515 q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q2ts30_carro GBP 679520 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint gbp-crp_1 679515 q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q2ts30_carro GBP 679520 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint a1kyq1-gbp 679515 q2ts30_carro GBP 679520 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a1kyq1_carro CRP 679518 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint crp_1-gbp-1 679516 q2ts30_carro GBP 679520 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3d f3e mint crp_1-fcn1-1 679517 q2ts39_carro CRP 679519 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified fcn1_human M-Ficolin 679523 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false kd 4 nanomolar f4c mint