MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schwertasse-2007-1 Selective redox regulation of cytokine receptor signaling by extracellular thioredoxin-1. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Schwertassek U., Balmer Y., Gutscher M., Weingarten L., Preuss M., Engelhard J., Winkler M., Dick TP. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation prdx2_human Peroxiredoxin-2 PRDX2 NKEFB TDPX1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Thiol-specific antioxidant protein PRP Natural killer cell-enhancing factor B Thioredoxin-dependent peroxiredoxin 2 protein protein human Homo sapiens Human MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK txn-prdx2 667143 prdx2_human PRX2 667144 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level thio_human TRX1 667145 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association false false false F1D F1E homomint mint txn-prdx1 667143 prdx1_human PRX1 667146 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level thio_human TRX1 667145 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association false false false F1E homomint mint