IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2007a-6 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-5 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-1 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-4 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-7 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-hcc-1937 Homo sapiens hcc-1937 human breast carcinoma established from a primary ductal carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Coimmunoprecipitations were carried out in lysates from control cells - deficient in BRCA1 - not transfected with BRCA1 vector. Cells were treated with IR or untreated. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-8 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-hcc-1937 Homo sapiens hcc-1937 human breast carcinoma established from a primary ductal carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Coimmunoprecipitations were carried out in lysates from cells transfected with BRCA1 vector. Cells were treated with IR or untreated. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-2 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-3 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-9 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to Abra1 or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-10 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to Bach1 or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-11 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to CtIP or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation wang-2007a-12 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Biotin-labeled phosphorylated or unphosphorylated Abraxas peptides were conjugated onto SA-chips and purified GST-Brca1-BRCT was used as an analyte. Resonance units were measured using BIAcore 3000. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation fancj_human Fanconi anemia group J protein BRIP1 BACH1 FANCJ ATP-dependent RNA helicase BRIP1 BRCA1-associated C-terminal helicase 1 BRCA1-interacting protein C-terminal helicase 1 protein protein human Homo sapiens Human MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGKPADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKINSFSPQKPPGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRTNIQDNESTLEVTSLKYSTSPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPSSIISRKEKNDPVFLEEAGKAEKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPELYDPEDTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDCIDTKLNGILHIEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK uimc1_human BRCA1-A complex subunit RAP80 Retinoid X receptor-interacting protein 110 Receptor-associated protein 80 Ubiquitin interaction motif-containing protein 1 UIMC1 RAP80 RXRIP110 protein protein human Homo sapiens Human MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQSVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY abrx1_human BRCA1-A complex subunit Abraxas 1 ABRAXAS1 ABRA1 CCDC98 Coiled-coil domain-containing protein 98 FAM175A Protein FAM175A UNQ496/PRO1013 protein protein human Homo sapiens Human MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF This sequence has been withdrawn from Uniprot. ctip_human DNA endonuclease RBBP8 RBBP8 CTIP CtBP-interacting protein Retinoblastoma-binding protein 8 Retinoblastoma-interacting protein and myosin-like Sporulation in the absence of SPO11 protein 2 homolog protein protein human Homo sapiens Human MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTRNTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVLDDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD fam175a-bach1 Abraxas coimmunoprecipitates BRCA1, BACH1, and Rap80 in 293T lysates 651354 n/a 651366 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role prey prey N/A 651368 unspecified role unspecified role prey prey N/A 651369 unspecified role unspecified role bait bait association association false false false 4 A This interaction occurs both with IR treatment and without IR treatment. fancj-brca1 Bach1 coimmunoprecipitates BRCA1 in 293T lysates 651354 n/a 651366 unspecified role unspecified role bait bait N/A 651368 unspecified role unspecified role prey prey physical association physical association false false false 4 A This interaction occurred both in the absence of treatment with IR and following IR treatment. rbbp8-brca1 CtIP coimmunoprecipitates BRCA1 in 293T lysates 651354 n/a 651370 unspecified role unspecified role bait bait N/A 651368 unspecified role unspecified role prey prey physical association physical association false false false 4 A This interaction occurred both in the absence of treatment with IR and following IR treatment. The bands for BRCA1 are very feint in Fig. 4 A but the authors state that Abraxas binds BRCA1 mutually exclusively with CtIP. brca1-bach1 BRCA1 coimmunoprecipitates BACH1, CtIP and Rap80 in 293T lysates 651354 n/a 651366 unspecified role unspecified role prey prey N/A 651368 unspecified role unspecified role bait bait N/A 651369 unspecified role unspecified role prey prey n/a 651370 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role prey prey association association false false false 4 A This interaction occurs both with IR treatment and without IR treatment, although the band for CtIP is feinter after IR. rxrip110-brca1-4 Rap80 coimmunoprecipitates BRCA1, CtIP and Abraxas in 293T lysates 651354 N/A 651369 unspecified role unspecified role prey prey N/A 651368 unspecified role unspecified role prey prey n/a 651370 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role bait bait association association false false false 4 A This interaction occurs both with IR treatment and without IR treatment. rxrip110-brca1-3 Rap80 coimmunoprecipitates BRCA1 in 293T lysates 651354 N/A 651368 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role bait bait physical association physical association false false false S5 B, S11 Ionizing radiation (IR) - this interaction was stimulated by treatment with 10 Gy IR. Lambda phosphatase - this interaction was abolished by treatment with lamda phosphatase, indicating that the interaction is phsophorylation-dependent. brca1-ccdc98 BRCA1 colocalizes with Abraxas in U2OS cells 651355 N/A 651368 unspecified role unspecified role neutral component neutral component N/A 651369 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 A This interaction occurred both with IR treatment and without IR treatment. ccdc98-rad51 RAD51 colocalizes with Abraxas in U2OS cells after IR 651355 N/A 651371 unspecified role unspecified role neutral component neutral component N/A 651369 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 A Ionizing radiation (IR) - this interaction occurred after treatment with 10 Gy IR followed by 4 hr incubation. brca1-rxrip110-1 BRCA1 colocalizes with Rap80 in U2OS cells 651355 N/A 651367 unspecified role unspecified role neutral component neutral component N/A 651368 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 B Ionizing radiation - IR (10 Gy followed by 2 hr incubation) stimulated this interaction. This interaction occurred both without IR treatment and after IR treatment. rad51-rxrip110 RAD51 colocalizes with Rap80 in U2OS cells after IR 651355 N/A 651367 unspecified role unspecified role neutral component neutral component N/A 651371 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 B Ionizing radiation (IR) - this interaction occurred after treatment with 10 Gy IR followed by 4 hr incubation. brca1-ccdc98-4 BRCA1 colocalizes with Abraxas in U2OS cells treated with UV 651355 N/A 651368 unspecified role unspecified role neutral component neutral component N/A 651369 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6UWZ7:p.Ser406Ala mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 3 C UV - this colocalization occurred after UV laser microirradiation (cells were fixed and stained 15 min after laser treatment). The S406A mutation appears to stimulate the colocalization, as seen in Fig. 3 C. ccdc98-brca1 GST-BRCA1-BRCT associates with C-terminal Abraxas peptide phosphorylated on Ser406 651356 N/A 651368 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 651369 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 A brca1-ccdc98-1 GST-BRCA1-BRCT associates with HA-Abraxas 651356 N/A 651369 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 651368 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P38398:p.Met1775Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 B, S2 B, C HA-Abraxas does not associate with the BRCT domains of MDC1 or 53BP1. Treatment of the cell lysates with lamda phosphatase abolished this interaction, indicating that only phosphorylates Abraxas interacts with BRCA1. brca1-ccdc98-5 GST-BRCA1-BRCT associates with HA-Abraxas 651356 N/A 651368 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 651369 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ser406ala opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction false false false 1 B, S2 D HA-Abraxas does not associate with the BRCT domains of MDC1 or 53BP1. Treatment of the cell lysates with lamda phosphatase abolished this interaction, indicating that only phosphorylates Abraxas interacts with BRCA1. brca1-rxrip110 GST-BRCA1-BRCT associates with Rap80 651356 N/A 651368 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 651367 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction false false false S5 A, C This interaction is phosphorylation-dependent as incubation of lysates with lambda phosphatase abolished the interaction. ccdc98-brca1-1 BRCA1 coimmunoprecipitates with HA-Abraxas in 293T lysates 651357 N/A 651369 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 651368 unspecified role unspecified role prey prey physical association physical association false false false 1 C Q6UWZ7 transfection ccdc98-rxrip110-2 HA-Abraxas coimmunoprecipitates Rap80 in 293T lysates 651357 N/A 651367 unspecified role unspecified role prey prey N/A 651369 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S9 The interaction was not affected by treatment with 10 GY IR. Q6UWZ7 transfection ccdc98-rbbp8 HA-Abraxas coimmunoprecipitates CtIP in 293T lysates 651357 N/A 651369 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 651370 unspecified role unspecified role prey prey physical association physical association false false false S12 Q6UWZ7 transfection rxrip110-ccdc98 Rap80 coimmunoprecipitates Abraxas in HCC1937 lysates 651358 N/A 651367 unspecified role unspecified role bait bait N/A 651369 unspecified role unspecified role prey prey physical association physical association false false false 4 B This interaction is independent of BRCA1 as HCC1937 cells are BRCA1-deficient. ccdc98-rxrip110 Rap80 coimmunoprecipitates with Abraxas in HCC1937 lysates 651358 N/A 651367 unspecified role unspecified role prey prey N/A 651369 unspecified role unspecified role bait bait physical association physical association false false false 4 B This interaction is independent of BRCA1 as HCC1937 cells are BRCA1-deficient. rxrip110-ccdc98-1 Rap80 coimmunoprecipitates Abraxas in HCC1937 lysates 651359 N/A 651369 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role bait bait physical association physical association false false false 4 B ccdc98-rxrip110-1 Rap80 coimmunoprecipitates with Abraxas in HCC1937 lysates 651359 N/A 651369 unspecified role unspecified role bait bait N/A 651367 unspecified role unspecified role prey prey physical association physical association false false false 4 B brca1-ccdc98-2 BRCA1 coimmunoprecipitates HA-Abraxas in 293T lysates 651360 N/A 651369 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 651368 unspecified role unspecified role bait bait physical association physical association false false false 1 C Q6UWZ7 trnasfection Mutation of Ser406 disrupts the interaction, indicating that phsophorylation of this residue is required for this interaction. brca1-brip1 BRCA1-BRCT-TAP copurifies BACH1, CTIP and RAP80 in HeLa cells 651361 n/a 651366 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role prey prey n/a 651370 unspecified role unspecified role prey prey N/A 651368 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false association association false false false 1 F rxrip110-brca1-1 Rap80 coimmunoprecipitates BRCA1 and Abraxas in 293T lysates 651362 N/A 651368 unspecified role unspecified role prey prey N/A 651367 unspecified role unspecified role bait bait N/A 651369 unspecified role unspecified role prey prey association association false false false 4 C This interaction was decreased by treatment with siRNA oligos to ABRA1. rxrip110-brca1 Rap80 coimmunoprecipitates BRCA1 in 293T lysates 651363 N/A 651367 unspecified role unspecified role bait bait N/A 651368 unspecified role unspecified role prey prey physical association physical association false false false 4 C Treatment with siRNA oligos to BACH1 did not affect this interaction. rxrip110-brca1-2 Rap80 coimmunoprecipitates BRCA1 in 293T lysates 651364 N/A 651367 unspecified role unspecified role bait bait N/A 651368 unspecified role unspecified role prey prey physical association physical association false false false 4 C Treatment with siRNA oligos to CtIP did not affect this interaction. ccdc98-brca1-2 651365 N/A 651368 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 651369 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false S2 A Only Abraxas peptides containing pSer406 bound GST-BRCA1-BRCT.