MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tremmel-2007-1 FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tremmel D., Duarte M., Videira A., Tropschug M. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation tremmel-2007-2 FKBP22 is part of chaperone/folding catalyst complexes in the endoplasmic reticulum of Neurospora crassa. neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tremmel D., Duarte M., Videira A., Tropschug M. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation q7s399_neucr Protein disulfide-isomerase NCU09223 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MHAPTKFALGLLAAAAVATASDVIQLKKDTFDDFVKTNDIVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIKLAKIDCTEESELCQQHGVEGYPTLKVFRGLEVVSPYKGQRKAAAITSYMIKQSLPSVSELNKDNIEEFKKADKVVIVAYLDAADKASNETFSKVADKLRDEYPFGASSDAALAEAEGVTAPAIVLYKDFDEGKAVFTEKFDPEAIEKFAKTASTPLIGEVGPDTYAGYMSAGIPLAYIFAETPEERKELSEALKSIAEAQRGVINFATIDAKAFGAHAGNLNLKADKFPAFAIQDTTKNLKFPFDQEKEITADSIKKFVDDFVAGKVEPTIKSEPIPETQEGPVTVVVAKSYDDIVLDDTKDVLIEFYAPWCGHCKALAPKYDELATLYANSDFKDKVVIAKVDATQNDVPDEIQGFPTIKLYAAGAKDKPVEYSGPRTVEDLIKFISENGKYKASPPAEAEESVAASAESGSSTETGTVEEPAKETSHDEL mint hsp70_neucr Heat shock 70 kDa protein hsps-1 B18E6.040 NCU09602 HSP70 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MAPAVGIDLGTTYSCVGVFREDRCEIIANDQGNRTTPSFVAFTDTERLVGDAAKNQVAMNPANTVFDAKRLIGRKFSDPEVQADMKHFPFKVIDRGGKPVIQVEFKGETKVFTPEEISAMILQKMKETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKVEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDLSTNARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCQDLFRSTLQPVDRVLTDAKIDKSQVHEIVLVGGSTRIPRIQKLISDYFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSSKSTSEILLLDVAPLSLGIETAGGMMTKLIPRNTTIPTKKSEVFSTFSDNQPGVLIQVYEGERQRTKDNNLLGKFELTGIPPAPRGVPQIEVTFDVDANGIMNVSALEKGTGKTNQITITNDKGRLSKEEIERMLAEAEKFKEEDEAEAKRVAAKNGLESYAYSLRNTLSDSKVDEKLDAADKEKLKSEIDKIVAWLDENQQATREEYEERQKELEAIANPIMMKFYGAGGAPGGMPGAAPGGFPGGAPGSNDNEGPTVEEVD mint bip_neucr Endoplasmic reticulum chaperone BiP grp78 NCU03982 Immunoglobulin heavy chain-binding protein homolog protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MEHRTRSWALGLSILGFFALLFSAGFVQQAHANDTEAMGTVIGIDLGTTYSCVGVMQKGKVEILVNDQGNRITPSYVAFTDEERLVGDAAKNQAAANPHRTIFDIKRLIGRKFSDKDVQNDIKHFPYKVVSKDDKPVVKVEVKGEEKTFTPEEISAMILGKMKETAEGYLGKKVTHAVVTVPAYFNDNQRQATKDAGMIAGLNVLRIVNEPTAAAIAYGLDKTGEERQIIVYDLGGGTFDVSLLSIEQGVFEVLSTAGDTHLGGEDFDQRIINHFAKLFNKKHGVDVTKDAKAMGKLKREAEKAKRTLSSQMSTRIEIEAFYDGKDFSETLTRAKFEELNNDLFKKTLKPVEQVLKDAKVSKSEIDDIVLVGGSTRIPKVQALIEEFFNGKKASKGINPDEAVAFGAAVQAGVLSGEEGTEDIVLMDVNPLTLGIETTGGVMTKLIPRNTPIPTRKSQIFSTAADNQPVVLIQVYEGERSMTKDNNLLGKFELTGIPPAPRGVPQIEVSFELDANGILKVSAHDKGTGKAESITITNDKGRLTQEEIDRMVAEAEKYAEEDKATRERIEARNGLENYAFSLKNQVNDEDGLGGKIDEEDKETILDAVKEAQDWLEENAATASAEDFDEQKEKLSNVAYPITSKLYSQGGAGDDEPAGHDEL Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER mint fkbp2_neucr FK506-binding protein 2 fkr-5 FK506-resistance protein 5 NcFKBP22 Peptidyl-prolyl cis-trans isomerase fkr-5 NCU02455 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MKSIFLSLSLLASATVGVLAAEELGIDVTVPVECDRKTRKGDKINVHYRGTLQSNGQQFDASYDRGTPFSFKLGGGQVIKGWDEGLVDMCIGEKRTLTVPPSYGYGQRSIGPIPAGSTLIFETELIGIDGVPKPESIVYKQAAEKAEEAASAVEEKVAEATDKAGGKIADATKKVEEKAEEASANVVEKVASVVSGAAEAVKTVVADTDDVQEHNEL mint PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides erp38_neucr Protein disulfide-isomerase erp38 erp38 17E5.50 NCU03739 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MVLLKSLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGDKNVLVAFTAPWCGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEADLVKFLNEKAGTHRTPGGGLDTVAGTIAALDEIVAKYTGGASLAEVAEEAKEAVKSLKNSAELKYADYYLRVLDKLSKSEGYATKEFARLEGILKKGGLAPAKVDELTVKVNVLRKFVEKAAEEAKEEL mint ppib_neucr Peptidyl-prolyl cis-trans isomerase B cpr2 Rotamase B 18F11.170 NCU01200 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MFSLRRLLLAATLFLGAMLLFAQSAEAAKGPKITHKVYFDIEQGDKPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHSKKGLLSMANAGKDTNGSQFFITTVITSWLDGKHVVFGEVLEGYDVVEKIENTKTGPRDAPAEPIKIAKSGELEVPPEGLEGQSEWASPAYANEDEKPAAPVPVTDAKPPAHDSIPAATADDDDTGAPLFAKVLFFGVLVLGLVLYIRLRRAPKGTYGKGME mint PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides fkbp22-cpr_2 608341 q7s399_neucr PDI 608343 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level hsp70_neucr Grp170 608344 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Glucosidase II alpha subunit 608345 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2 mint fkbp22-cpr_2-1 608341 fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3B mint grp78-cpr_2 608341 fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3C mint q7s399-cpr_2 608341 fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3C mint erp38-cpr_2 608341 q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3C mint fkbp22-cpr_2-2 608341 erp38_neucr erp38 608347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ppib_neucr cyp23 608348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3C mint cpr_2-erp38 608341 ppib_neucr cyp23 608348 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level erp38_neucr erp38 608347 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3C mint fkbp22-grp78 608342 fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false F4 mint fkbp22-grp78-1 608342 q7s399_neucr PDI 608343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level grp78_neucr Bip 608345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level fkbp2_neucr fkbp22 608346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false F4B Microsomes were treated with DSP. mint