MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zito-2007-1 Sulfatase modifying factor 1 trafficking through the cells: from endoplasmic reticulum to the endoplasmic reticulum. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. imaging technique imaging technique microscopy predetermined predetermined participant predetermined Zito E., Buono M., Pepe S., Settembre C., Annunziata I., Surace EM., Dierks T., Monti M., Cozzolino M., Pucci P., Ballabio A., Cosma MP. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation hcd2_mouse 3-hydroxyacyl-CoA dehydrogenase type-2 Erab Hsd17b10 Hadh2 3-hydroxyacyl-CoA dehydrogenase type II Type II HADH 3-hydroxy-2-methylbutyryl-CoA dehydrogenase Mitochondrial ribonuclease P protein 2 Endoplasmic reticulum-associated amyloid beta-peptide-binding protein 17-beta-estradiol 17-dehydrogenase 2-methyl-3-hydroxybutyryl-CoA dehydrogenase 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)) 3alpha(or 20beta)-hydroxysteroid dehydrogenase 7-alpha-hydroxysteroid dehydrogenase Short chain dehydrogenase/reductase family 5C member 1 Short-chain type dehydrogenase/reductase XH98G2 protein protein mouse Mus musculus Mouse MAAAVRSVKGLVAVVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESQAKKLGESCIFAPANVTSEKEIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIDGMTLPIARDLAPTGIRVVTIAPGLFATPLLTTLPEKVRNFLASQVPFPSRLGDPAEYAHLVQTIIENPFLNGEVIRLDGAIRMQP mint sumf1_human Formylglycine-generating enzyme C-alpha-formylglycine-generating enzyme 1 SUMF1 UNQ3037/PRO9852 PSEC0152 Sulfatase-modifying factor 1 protein protein human Homo sapiens Human MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD lamp1_mouse Lysosome-associated membrane glycoprotein 1 Lysosomal membrane glycoprotein A 120 kDa lysosomal membrane glycoprotein LGP-120 P2B CD107 antigen-like family member A Lamp1 Lamp-1 protein protein mouse Mus musculus Mouse MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI hsd17b10-sumf1 653565 hcd2_human ERAB 653566 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell sumf1_human SUMF1 653567 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F2 organelles The same occurs in Hela cells. homomint mint lamp1-sumf1 653565 lamp1_human LAMP1 653568 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell sumf1_human SUMF1 653567 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F2 organelles The same occurs in Hela cells. homomint mint