IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ colf-2007-1 How a single T cell receptor recognizes both self and foreign MHC. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. The description of the proteins used determiend from back references and this publication. kcgarcia@stanford.edu Cell (0092-8674) 2007 Only protein-protein interactions 3 imex curation colf-2007-2 How a single T cell receptor recognizes both self and foreign MHC. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Colf LA., Bankovich AJ., Hanick NA., Bowerman NA., Jones LL., Kranz DM., Garcia KC. kcgarcia@stanford.edu Cell (0092-8674) 2007 Only protein-protein interactions 3 imex curation The description of the proteins used determiend from back references and this publication. q6p8i7_mouse Oxoglutarate dehydrogenase (succinyl-transferring) Ogdh protein protein mouse Mus musculus Mouse MHSPWWKHNLTSTNSWRTTWRCSLSSGHIRSGVTTLQNLILRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS a2ntu7_mouse protein protein mouse Mus musculus Mouse MLLALLPVLGIHFVLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS a2nty6_mouse protein protein mouse Mus musculus Mouse MSNTAFPDPAWNTTLLSWVALFLLGTKHMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGELGGFNQDTQYFGPGTRLLVL ha1l_mouse H-2 class I histocompatibility antigen, L-D alpha chain H2-L protein protein mouse Mus musculus Mouse MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLGEPRYISVGYVDNKEFVRFDSDAENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA tcr-mhc 651698 N/A 651700 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 651701 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 651702 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 651703 unspecified role unspecified role neutral component neutral component P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Table S1. working 22.4 percent, free 24.6 percent 2.50 A The protein H2-L had additional mutation F9Y (possibly F8 in UniProtKB entry) which increased solubility of the proteins. These residue posiiton however does not correspond with the UniProtKB entry. The cytotoxic T-cell receptor precursor described here has mutation in the linker V beta 8.2 region to increase solubility. The mutations described are gly17glu his47tyr iso75thr leu81ser tcr-mhc-1 651698 N/A 651701 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 651702 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 651700 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 651703 unspecified role unspecified role neutral component neutral component P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Table S1. Fig S2, S3 working 22.0 percent, free 22.6 percent 2.35 A The protein H2-L had additional mutation F9Y (possibly UniProtKB entry residue F8) which increased solubility of the protein. tcr-mhc-2 651699 N/A 651701 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 651702 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 651700 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 651703 unspecified role unspecified role neutral component neutral component extracellular region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P01897:p.[Val36Thr;Ile47Thr] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false figure 5B. The protein H2-L had additional mutation F9Y which increased solubility of the proteins. These residue position however do not correspond to the UniProtKB entry. The Cytotoxic Tcell receptor precursor described here has mutation in the linker V beta 8.2 region to increase solubility. The mutations described are gly17glu his47tyr iso75thr leu81ser TCR with the gly17glu his47tyr iso75thr leu81ser mutations shows a Kd of 0.029 micromoles.