MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint meisinger-2007-1 The morphology proteins Mdm12/Mmm1 function in the major beta-barrel assembly pathway of mitochondria. yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Meisinger C., Pfannschmidt S., Rissler M., Milenkovic D., Becker T., Stojanovski D., Youngman MJ., Jensen RE., Chacinska A., Guiard B., Pfanner N., Wiedemann N. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation mdm12_yeast Mitochondrial distribution and morphology protein 12 YOL009C MDM12 Mitochondrial inheritance component MDM12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEITDPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFLCDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE D4A89786CE59CAB4 sam35_yeast Sorting assembly machinery 35 kDa subunit YHR083W SAM35 OMP85 TOB38 TOM38 TOB complex 38 kDa subunit Mitochondrial 38 kDa outer membrane protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSSFSVPMPVKRIFDTFPLQTYAAQTDKDEAVALEIQRRSYTFTERGGGSSELTVEGTYKLGVYNVFLEANTGAALATDPWCLFVQLALCQKNGLVLPTHSQEQTPSHTCNHEMLVLSRLSNPDEALPILVEGYKKRIIRSTVAISEIMRSRILDDAEQLMYYTLLDTVLYDCWITQIIFCASDAQFMELYSCQKLSGSIVTPLDVENSLLQKLSAKSLKISLTKRNKFQFRHREIVKSMQGVYHNHHNSVNQEQVLNVLFENSKQVLLGLKDMLKSDGQPTYLHLKIASYILCITNVKEPIKLKTFVENECKELVQFAQDTLKNFVQ mmm1_yeast Maintenance of mitochondrial morphology protein 1 MMM1 Yeast mitochondrial escape protein 6 Mitochondrial outer membrane protein MMM1 YME6 L1357 YLL006W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDSENESTETDSLMTFDDYISKELPEHLQRLIMENLKGSTTNDLKQTSNNSEFNVSKNGSFKGLDDAIQALQMQSVLHPSSLGSLATSSKFSGWSFAQGFFVGQLSIVLLFIFFLKFFIFSDEPSKSKNPKPAASRHRSKFKEYPFISREFLTSLVRKGAKQHYELNEEAENEHLQELALILEKTYYNVDVHPAESLDWFNVLVAQIIQQFRSEAWHRDNILHSLNDFIGRKSPDLPEYLDTIKITELDTGDDFPIFSNCRIQYSPNSGNKKLEAKIDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFASTSNGSSSENGMEGNSGYFLMFSFSPEYRMEFEIKSLIGSRSKLENIPKIGSVIEYQIKKWFVERCVEPRFQFVRLPSMWPRSKNTREEKPTEL 3610AEC2109355AF sam50_yeast Sorting assembly machinery 50 kDa subunit SAM50 YNL026W N2802 TOB55 TOB complex 55 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSSSGVDNEISLDSPMPIFNESSTLKPIRVAGVVTTGTDHIDPSVLQAYLDDTIMKSITLGQLVKNADVLNKRLCQHHIALNAKQSFHFQGNTYISDEKETHDVVPLMEVVSQLDILPPKTFTAKTGTNFGNDNDAEAYLQFEKLIDKKYLKLPTRVNLEILRGTKIHSSFLFNSYSSLSPQSILNLKVFSQFYNWNTNKGLDIGQRGARLSLRYEPLFLHKLLHNPHSNESPTLFHEWFLETCWRSTKICSQGTSAPYMYSGTMLSQAGDQLRTILGHTFVLDKRDHIMCPTKGSMLKWSNELSPGKHLKTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAFL mdm10_yeast Mitochondrial distribution and morphology protein 10 MDM10 YAL010C FUN37 Mitochondrial inheritance component MDM10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPYMDQVLRAFYQSTHWSTQNSYEDITATSRTLLDFRIPSAIHLQISNKSTPNTFNSLDFSTRSRINGSLSYLYSDAQQLEKFMRNSTDIPLQDATETYRQLQPNLNFSVSSANTLSSDNTTVDNDKKLLHDSKFVKKSLYYGRMYYPSSDLEAMIIKRLSPQTQFMLKGVSSFKESLNVLTCYFQRDSHRNLQEWIFSTSDLLCGYRVLHNFLTTPSKFNTSLYNNSSLSLGAEFWLGLVSLSPGCSTTLRYYTHSTNTGRPLTLTLSWNPLFGHISSTYSAKTGTNSTFCAKYDFNLYSIESNLSFGCEFWQKKHHLLETNKNNNDKLEPISDELVDINPNSRATKLLHENVPDLNSAVNDIPSTLDIPVHKQKLLNDLTYAFSSSLRKIDEERSTIEKFDNKINSSIFTSVWKLSTSLRDKTLKLLWEGKWRGFLISAGTELVFTRGFQESLSDDEKNDNAISISATDTENGNIPVFPAKFGIQFQYST 5AE98366B5EF25E5 sam37_yeast Sorting assembly machinery 37 kDa subunit SAM37 MAS37 PET3027 TOM37 Mitochondrial 37 kDa outer membrane protein MAS37 protein YM9796.13C YMR060C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKGSVHLWGKDGKASLISVDSIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKLPVLILDNGTKVSGYVNIVQFLHKNICTSKYEKGTDYEEDLAIVRKKDRLLEYSLLNYVDVEISRLTDYQLFLNTKNYNEYTKKLFSKLLYFPMWYNTPLQLRSQARENCEEIIGSLTLEDDEEFVESKAMESASQLAQSKTFKIAHKNKIKGKQELQQVKYNLQFDNRLQSCVSNWLAARKKLDDSVILSSDLLFLANLYVQLGLPDGNRIRSKLEQTFGSELLNSMSNKIDDFVHRPSNNLEQRDPQFREQGNVVMSLYNLACKYI mdm10-mdm12 650637 mdm12_yeast MDM12 650638 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sam35_yeast SAM35 650639 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mmm1_yeast MMM1 650640 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sam50_yeast 650641 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mdm10_yeast 650642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sam37_yeast SAM37 650643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false F1A mint mdm12-mdm10 650637 mdm10_yeast 650642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mdm12_yeast 650638 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mmm1_yeast MMM1 650640 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false F1C mint mmm1-mdm10 650637 mdm12_yeast MDM12 650638 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mdm10_yeast 650642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mmm1_yeast 650640 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F1B mint sam35-mdm10 650637 sam37_yeast SAM37 650643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sam35_yeast 650639 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sam50_yeast SAM50 650641 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mdm10_yeast 650642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false F1D mint