IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ikeda-2007-1 Molecular basis of late-flowering phenotype caused by dominant epi-alleles of the FWA locus in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ikeda Y., Kobayashi Y., Yamaguchi A., Abe M., Araki T. taraqui@lif.kyoto-u.ac.jp Plant Cell Physiol. (0032-0781) 2007 ikeda-2007-2 Molecular basis of late-flowering phenotype caused by dominant epi-alleles of the FWA locus in Arabidopsis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ikeda Y., Kobayashi Y., Yamaguchi A., Abe M., Araki T. taraqui@lif.kyoto-u.ac.jp Plant Cell Physiol. (0032-0781) 2007 fwa_arath Homeobox-leucine zipper protein HDG6 HDG6 At4g25530 M7J2.100 FWA HDGL2-6 Homeodomain transcription factor HDG6 HD-ZIP protein HDG6 Protein HOMEODOMAIN GLABROUS 6 Homeodomain GLABRA 2-like protein 6 Homeobox protein FWA protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGQGDLDAVGNIPKPGEAEGDEIDMINDMSGVNDQDGGRMRRTHRRTAYQTQELENFYMENPHPTEEQRYELGQRLNMGVNQVKNWFQNKRNLEKINNDHLENVTLREEHDRLLATQDQLRSAMLRSLCNICGKATNCGDTEYEVQKLMAENANLEREIDQFNSRYLSHPKQRMVSTSEQAPSSSSNPGINATPVLDFSGGTRTSEKETSIFLNLAITALRELITLGEVDCPFWMIDPIVRSKGVSKIYEKYRSSFNNVTKPPGQIVEASRAKGLVPMTCVTLVKTLMDTGKWVNVFAPIVPVASTHKVLSTGSGGTKSGSLQQIQAEFQVISPLVPKRKVTFIRYCKEIRQGLWVVVDVTPTQNPTLLPYGCSKRLPSGLIIDDLSNGYSQVTWIEQAEYNESHIHQLYQPLIGYGIGLGAKRWLATLQRHCESLSTLSSTNLTEISPGLSAKGATEIVKLAQRMTLNYYRGITSPSVDKWQKIQVENVAQNMSFMIRKNVNEPGELTGIVLSASTSVWLPVNQHTLFAFISHLSFRHEWDILTNDTTMEETIRIQKAKRHGNIISLLKIVNNGMLVLQEIWNDASGAMVVYAPVETNSIELVKRGENSDSVKFLPSGFSIVPDGVNGSYHRGNTGGGCLLTFGLQILVGINPTAALIQGTVKSVETLMAHTIVKIKSALDLQT ft_arath Protein FLOWERING LOCUS T FT At1g65480 F5I14.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL ft-fwa Yeast 2 hybrid analysis reveals interaction between FT protein and the FWA protein 665374 N/A 665376 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 665377 unspecified role unspecified role bait bait physical association physical association false false false 5 & 6 The authors note that analysis using regions shown to be essential to interaction between FWA and FT demonstrated that regions outside these were also required for interaction to occur. fwa-fwa Yeast 2 hybrid analysis reveals FWA homodimer formation 665374 N/A 665376 unspecified role unspecified role prey prey N/A 665376 unspecified role unspecified role bait bait physical association physical association false false false 6 ft-fwa-1 Pulldown analysis reveals interaction between FT protein and the FWA protein 665375 N/A 665376 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 665377 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 6