IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2006c-1 A keratin cytoskeletal protein regulates protein synthesis and epithelial cell growth. mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Kim S., Wong P., Coulombe PA. coulombe@jhmi.edu Nature (0028-0836) 2006 kim-2006c-2 A keratin cytoskeletal protein regulates protein synthesis and epithelial cell growth. mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kim S., Wong P., Coulombe PA. coulombe@jhmi.edu Nature (0028-0836) 2006 kim-2006c-3 A keratin cytoskeletal protein regulates protein synthesis and epithelial cell growth. mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Kim S., Wong P., Coulombe PA. coulombe@jhmi.edu Nature (0028-0836) 2006 k1c17_mouse Keratin, type I cytoskeletal 17 Krt17 Krt1-17 Keratin-17 Cytokeratin-17 protein protein mouse Mus musculus Mouse MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGAGSCRLGSASGLGSALGSNSYSSCYSFGTGSGYGGNFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQKQAPGPARDYSAYYHTIEDLKNKILVATVDNASILLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR 1433s_mouse 14-3-3 protein sigma Sfn Mkrn3 Stratifin protein protein mouse Mus musculus Mouse MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS krt17-sfn CoIP showing the interaction between Krt17 and sfn. 671921 N/A 671924 unspecified role unspecified role bait bait mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] N/A 671925 unspecified role unspecified role prey prey mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] physical association physical association false false false Supplementary Figures 3a-c. By okadaic acid (a serine/threonine phosphatase inhibitor) and by orthophosphates. Krt17 interacts with 14-3-3sigma in a phosphorylation-dependent manner. krt17-sfn-1 Colocalization observed by immunofluourescence showing the interaction between Krt17 and sfn. 671922 N/A 671925 unspecified role unspecified role neutral component neutral component mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] N/A 671924 unspecified role unspecified role neutral component neutral component mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] colocalization colocalization false false false Supplementary Figure 3d By wounded or stressed epithelium. The authors noted that ". Like K17 protein , 14-3-3 sigma protein; is clearly induced in the wound edge epithelium after skin injury ". krt17-sfn-2 CoIP showing the interaction between Krt17 and sfn. 671923 N/A 671924 unspecified role unspecified role bait bait ser44ala binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false thr9ala binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell N/A 671925 unspecified role unspecified role prey prey mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell physical association physical association false false false Supplementary Figures 4a,b. Relative to wild-type Krt17, its' interaction with 14-3-3sigma, in transfected cells, was significantly reduced in the single mutants T9A and S44A as well as with the double mutant T9A/S44A.