UniProt UniProt http://www.uniprot.org dunn-2006-1 A genomewide screen for petite-negative yeast strains yields a new subunit of the i-AAA protease complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dunn CD., Lee MS., Spencer FA., Jensen RE. Co-immunoprecipitation experiments were performed on isolated mitochondria solubilized in buffer containing 1 percent digitonin. rjensen@jhmi.edu Mol. Biol. Cell (1059-1524) 2006 dunn-2006-2 A genomewide screen for petite-negative yeast strains yields a new subunit of the i-AAA protease complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Dunn CD., Lee MS., Spencer FA., Jensen RE. Co-immunoprecipitation experiments were performed on isolated mitochondria solubilized in buffer containing 1 percent digitonin. rjensen@jhmi.edu Mol. Biol. Cell (1059-1524) 2006 yme1_yeast Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 YME1 OSD1 YTA11 YP9367.04 YPR024W Tat-binding homolog 11 Protein OSD1 Yeast mitochondrial escape protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVSKILVSPTVTTNVLRIFAPRLPQIGASLLVQKKWALRSKKFYRFYSEKNSGEMPPKKEADSSGKASNKSTISSIDNSQPPPPSNTNDKTKQANVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLLTASSAGAVNPSLASSSSNQSGYHGNFPSMYSPLYGSRKEPLHVVVSESTFTVVSRWVKWLLVFGILTYSFSEGFKYITENTTLLKSSEVADKSVDVAKTNVKFDDVCGCDEARAELEEIVDFLKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDVRGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSHFEWAKDKILMGAERKTMVLTDAARKATAFHEAGHAIMAKYTNGATPLYKATILPRGRALGITFQLPEMDKVDITKRECQARLDVCMGGKIAEELIYGKDNTTSGCGSDLQSATGTARAMVTQYGMSDDVGPVNLSENWESWSNKIRDIADNEVIELLKDSEERARRLLTKKNVELHRLAQGLIEYETLDAHEIEQVCKGEKLDKLKTSTNTVVEGPDSDERKDIGDDKPKIPTMLNA mgr1_yeast Mitochondrial inner membrane i-AAA protease supercomplex subunit MGR1 YCL044C YCL44C YCL314 MGR1 Mitochondrial genome-required protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTLITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFPTLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPWCDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEAQNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSSTGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKKRSSTTLSRGVILPHDTKGPQDIDLDTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH 39055E8ECF6C3B9B mgr1-yme1 672420 N/A 672422 unspecified role unspecified role prey prey N/A 672423 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig: 3A mgr1-yme1-1 672420 N/A 672422 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 672423 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig: 3B mgr1-yme1-2 672421 N/A 672423 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 672422 unspecified role unspecified role neutral component neutral component c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig: 4