UniProt UniProt http://www.uniprot.org mashima-2005-3 FLN29, a novel interferon- and LPS-inducible gene acting as a negative regulator of toll-like receptor signaling. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mashima R., Saeki K., Aki D., Minoda Y., Takaki H., Sanada T., Kobayashi T., Aburatani H., Yamanashi Y., Yoshimura A. The origin of prey proteins is ambiguously described in the publication and were deduced from the experimental context. yakihiko@bioreg.kyushu-u.ac.jp. J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation mashima-2005-1 FLN29, a novel interferon- and LPS-inducible gene acting as a negative regulator of toll-like receptor signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Mashima R., Saeki K., Aki D., Minoda Y., Takaki H., Sanada T., Kobayashi T., Aburatani H., Yamanashi Y., Yoshimura A. yakihiko@bioreg.kyushu-u.ac.jp. J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation mashima-2005-2 FLN29, a novel interferon- and LPS-inducible gene acting as a negative regulator of toll-like receptor signaling. mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mashima R., Saeki K., Aki D., Minoda Y., Takaki H., Sanada T., Kobayashi T., Aburatani H., Yamanashi Y., Yoshimura A. RAW cells overexpressing Trafd1/FLN29 have been used. yakihiko@bioreg.kyushu-u.ac.jp. J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation trad1_mouse TRAF-type zinc finger domain-containing protein 1 Protein FLN29 Trafd1 Fln29 protein protein mouse Mus musculus Mouse MAEFRDDQASRLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHMAAEHCQVTCKCNKKLEKRQLKQHAETECPLRLAVCQHCDLELSVVKLKEHEDYCGARTELCGSCGRNVLVKELKTHPEVCGRVEEEKRTEAAIPPEAYDEPWSQDRIWIASQLLRQIEALDPPMRLPGRPLQAFEADPFYSRTTSQRSMAAQFPVQNNLFEEQERQERNRSRQSPKDSAENNAHLDFMLALSLQNEGQATSMVEQGFWESVPEADPARAGPTSLGDIKGAADEILLPCEFCEELYPEELLIDHQTSCNPSHALRSLNTGSSSIRGVEDPGTIFQNFLQQATSNQFDTLMGLSSSAAVEDSIIIPCEFCGVQLEEEVLFYHQDQCDQRPATANHRAVEGIPAQDSQPENTSAELSRRRVKHQGDLSSGYMDDVKPESVKGPTYSMSPNRTMNNVASCNRLLNLPSGPRSDCQRSPPGVLKLNNSDSQDIRGQMRGSQNGPIASGHAPVIHSIQNLYPENFAPSFPHGSPGRYGAGGRSEGGRSSRVSPAAAGYHSRAAKAKPPKQQGAGDAEEEEE traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV trad1_human TRAF-type zinc finger domain-containing protein 1 TRAFD1 FLN29 Protein FLN29 protein protein human Homo sapiens Human MAEFLDDQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTCKCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPDVIFQNFLQQAASNQLDSLMGLSNSHPVEESIIIPCEFCGVQLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANGPTSCLPPSRPINNMTATYNQLSRSTSGPRPGCQPSSPCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGDAEEEEEE traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV traf6-trafd1-3 666866 N/A 666869 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 666870 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 6B traf6-trafd1-4 666866 N/A 666869 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 666870 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 6C traf6-trafd1-1 666867 N/A 666871 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 666872 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 5B traf6-trafd1-2 666868 N/A 666871 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 N/A 666870 unspecified role unspecified role bait bait physical association physical association false false false 5C