IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ purushotham-2005-1 Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr Mol. Cell. Biol. (0270-7306) 2005 Only protein-protein interactions imex curation purushothaman-2005-1 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Purushothaman SK., Bujnicki JM., Grosjean H., Lapeyre B. bruno.lapeyre@crbm.cnrs.fr Mol. Cell. Biol. (0270-7306) 2005 Only protein-protein interactions imex curation tr112_yeast Multifunctional methyltransferase subunit TRM112 YNR046W N3445 TRM112 tRNA methyltransferase 112 eRF1 methyltransferase subunit TRM112 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV trm11_yeast tRNA (guanine(10)-N2)-methyltransferase tRNA [Gm10] methyltransferase tRNA methylase 11 TRM11 YOL124C tRNA guanosine-2'-O-methyltransferase TRM11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKKYLLYMVQVHLNFRRAELESLADLYNLSIDFSQYDANSPFFIVELENDQQAKDWIKRSILTRGIYEYWGQGTTLDELHKDIQRQSNFEQDLQLKFKHSTFKFEFECYKGNSKAKRVEQIETFRYLGFEGKIDMKHPQEVFTVIEEYTPISENVGGKTPTRIYFGRQVQMSNRSAMEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGTIMYDPFAGTGSFLVAGGHFGSLVIGSDIDGRMIRGKGAQVNISANFKKYGESSQFLDVLTMDFTNNALRNNLVIDTILCDPPYGIRESIKVLGAKDPERFLGKEDMEIDGEKAYLRRDYIPTKKPYALDSLLDDLLQYSSERLPIGGRLAFWMPTANDANIETIVPMHENLELKYNCVQEFNKWSRRLLVYINRGSTFNGSSNHGIKRSKDNFRERYFNNFN trna ile uau trna ile uau trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCUCGUGUAGCUCAGUGGUUAGAGCUUCGUGCUUAUAACGCGACCGUCGUGGGUUCAAACCCCACCUCGAGCA trm11-trm112-1 Interaction between Trm11 and Trm112 identified by coimmunoprecipitation 608659 N/A 608661 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608662 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4C trna ile-1 608660 N/A 608662 enzyme enzyme neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast N/A 608661 enzyme regulator enzyme regulator neutral component neutral component tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeast Saccharomyces cerevisiae Baker's yeast N/A 608663 enzyme target enzyme target substrate substrate neutral component neutral component G methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false in vitro In vitro methylation methylation reaction methylation false false false Fig 4A