IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ karimova-2005-1 Interaction network among Escherichia coli membrane proteins involved in cell division as revealed by bacterial two-hybrid analysis. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Karimova G., Dautin N., Ladant D. The bacterial adenylate cyclase two-hybrid (BACTH) system works by interaction-mediated reconstruction of a cyclic AMP (cAMP) signaling cascade. Target membrane proteins are fused to two fragments (T25 and T18) of catalytic domain of Bordatella pertussis adenylate cyclase (AC) and coexpressed in E. coli cya (strain deficient in endogenous AC). Interaction of hybrid proteins in the membrane leads to functional complementation of T25 and T18 fragments causing cAMP synthesis which acitvates transcription of catabolic operons e.g., lactose operon and maltose regulon, allowing the bacteria to utilize lactose and maltose. karimova@pasteur.fr J. Bacteriol. (0021-9193) 2005 ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF ftsi_ecoli Peptidoglycan D,D-transpeptidase FtsI ftsI pbpB b0084 Penicillin-binding protein 3 JW0082 Essential cell division protein FtsI Murein transpeptidase Peptidoglycan synthase FtsI protein protein ecoli Escherichia coli (strain K12) MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS This sequence has been withdrawn from Uniprot. ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG ftsq_ecoli Cell division protein FtsQ ftsQ b0093 JW0091 protein protein ecoli Escherichia coli (strain K12) MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ ftsl_ecoli Cell division protein FtsL ftsL mraR b0083 JW0081 yabD protein protein ecoli Escherichia coli (strain K12) MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQK ftsx_ecoli Cell division protein FtsX ftsX ftsS b3462 JW3427 protein protein ecoli Escherichia coli (strain K12) MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE ymgf_ecoli Inner membrane protein YmgF ymgF b4520 JW1156 protein protein ecoli Escherichia coli (strain K12) MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNRLRERLVNHRDQQ ftsw_ecoli Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Lipid II flippase FtsW Peptidoglycan polymerase JW0087 b0089 protein protein ecoli Escherichia coli (strain K12) MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPMEFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDYETRLEKAQAFVRGSR ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD ftsb_ecoli Cell division protein FtsB ftsB b2748 JW2718 ygbQ protein protein ecoli Escherichia coli (strain K12) MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR ftsa-ftsa FtsA interacts with itself in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsa-ftsi FtsA interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsa-ftsn FtsA interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsa-ftsq FtsA interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 FtsQ19-276 and FtsQ1-266 displayed reduced binding to FtsA as compared to the wild-type protein. ftsi-ftsn FtsN interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsn-ftsq FtsN interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 ftsn-ftsn FtsN interacts with itself in a bacterial two-hybrid assay 597345 N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsa-ftsq-1 FtsQ interacts with FtsA in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ftsq FtsQ interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597347 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 4 FtsI1-70, missing most of the periplasmic part of the protein, interacted with FtsQ as efficiently as full-length FtsI.FtsI19-52 interacted with FtsQ with reduced efficiency compared to FtsI1-70 but did not interact with FtsL, FtsW and YmgF. FtsI19-51 encompasses the transmembrane domain and 10 aa (42-51) of the periplasmic part of FtsI. ftsl-ftsq FtsQ interacts with FtsL in a bacterial two-hybrid assay 597345 N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsn-ftsq-1 FtsQ interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsq-ftsq FtsQ interacts with itself in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 FtsQ1-266 displayed reduced dimerization as compared to the wild-type FtsQ. ftsq-ftsx FtsQ interacts with FtsX in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597351 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsq-ymgf FtsQ interacts with YmgF in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsq-ftsx-1 FtsX interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 597351 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 FtsQ19-276 and FtsQ1-266 showed reduced binding to FtsX as compared to wild-type FtsQ. ftsa-ftsx FtsX interacts with FtsA in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597351 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsa-ftsl FtsI interacts with FtsL in a bacterial two-hybrid assay 597345 N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ftsn-1 FtsI interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ymgf FtsI interacts with YmgF in a bacterial two-hybrid assay 597345 N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ftsw FtsW interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597347 unspecified role unspecified role neutral component neutral component c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597353 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 4 FtsI1-70, missing most of the periplasmic part of the protein, interacted with FtsW as efficiently as full-length FtsI. ftsl-ftsw FtsW interacts with FtsL in a bacterial two-hybrid assay 597345 N/A 597353 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsn-ftsw FtsW interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597353 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ymgf-1 YmfG interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 4 FtsI1-70 displayed reduced interaction with YmgF as compared with full length FtsI. ftsn-ymgf YmfG interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsq-ymgf-1 YmfG interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 FtsQ1-246 interacted efficiently with YmgF, although it did not with any of the tested Fts proteins. ftsa-ftsz FtsZ interacts with FtsA in a bacterial two-hybrid assay 597345 N/A 597346 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597354 unspecified role unspecified role neutral component neutral component c-terminal T25 fragment of B. pertussis adenylate cyclase tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2 ftsl-ftsq-1 FtsL interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 ftsl-ymgf FtsL interacts with YmgF in a bacterial two-hybrid assay 597345 N/A 597352 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsb-ftsl FtsL interacts with FtsB in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 Coexpression of FtsL reduced complementation between T18-FtsB and T25-FtsL, suggesting free FtsL competed with T25-FtsL for binding to T18-FtsB. ftsi-ftsl FtsL interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2, 4 FtsI1-70 displayed reduced binding to FtsL. ftsl-ftsn FtsL interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsb-ftsi FtsB interacts with FtsI in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsb-ftsl-1 FtsB interacts with FtsL in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597350 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsb-ftsn FtsB interacts with FtsN in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597348 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsb-ftsq FtsB interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2 ftsi-ftsq-1 FtsI interacts with FtsQ in a bacterial two-hybrid assay 597345 N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2, 3 FtsQ1-266 displayed diminished binding to FtsI as compared to wild-type FtsQ. ftsb-ftsq-1 FtsQ interacts with FtsB in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597349 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5 Overexpression of FtsL enhanced association between FtsB and FtsQ. This could be due to overexpressed FtsL stabilizing T18-FtsB hybrids or stabilizing the complex between FtsB and FtsQ. ftsb-ftsw FtsW interacts with FtsB in the presence of overexpressed FtsL in a bacterial two-hybrid assay 597345 N/A 597350 unspecified role unspecified role ancillary ancillary N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597353 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5 This interaction only occurred in the presence of overexpression of FtsL. As FtsL can interact with FtsB and FtsW, this suggests that FtsL may bridge the two hybrid proteins to form a ternary complex. ftsb-ftsi-1 FtsI interacts with FtsB in the presence of overexpression of FtsL in a bacterial two-hybrid assay 597345 N/A 597355 unspecified role unspecified role neutral component neutral component n-terminal T18 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597347 unspecified role unspecified role neutral component neutral component n-terminal T25 fragment of B. pertussis adenylate cyclase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 597350 unspecified role unspecified role ancillary ancillary physical association physical association false false false 5 This interaction only occurs in the presence of overexpressed FtsL. As FtsL can interact with FtsB and FstsI, it suggests that FtsL may bridge the two hybrid proteins and form a ternary complex.