IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2004d-1 Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang Y., Jack T. thomas.p.jack@dartmouth.edu Plant Mol. Biol. (0167-4412) 2004 IMEx Only protein-protein interactions imex curation yang-2004d-2 Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Yang Y., Jack T. thomas.p.jack@dartmouth.edu Plant Mol. Biol. (0167-4412) 2004 IMEx Only protein-protein interactions imex curation yang-2004d-3 Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse two hybrid reverse two hybrid predetermined predetermined participant predetermined Yang Y., Jack T. thomas.p.jack@dartmouth.edu Plant Mol. Biol. (0167-4412) 2004 IMEx Only protein-protein interactions imex curation sep1_arath Developmental protein SEPALLATA 1 Agamous-like MADS-box protein AGL2 SEP1 AGL2 At5g15800 F14F8_180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML ap3_arath Floral homeotic protein APETALA 3 AP3 At3g54340 T12E18_30 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLVDNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE sep2_arath Developmental protein SEPALLATA 2 Agamous-like MADS-box protein AGL4 SEP2 AGL4 At3g02310 F14P3.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI pist_arath Floral homeotic protein PISTILLATA PI At5g20240 F5O24.130 Transcription factor PI protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMIDYCCPSMDLGAMLDQYQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQMEILISKRRNEKMMAEEQRQLTFQLQQQEMAIASNARGMMMRDHDGQFGYRVQPIQPNLQEKIMSLVID ap1_arath Floral homeotic protein APETALA 1 Agamous-like MADS-box protein AGL7 AP1 AGL7 At1g69120 F4N2.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA ag_arath Floral homeotic protein AGAMOUS F13C5.130 AG At4g18960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV sep1-ap3 Interaction between SEP1 and AP3 proteins 666275 N/A 666278 unspecified role unspecified role prey prey N/A 666279 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-ap3 Interaction between SEP2 and AP3 proteins 666275 N/A 666280 unspecified role unspecified role prey prey N/A 666279 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep3-ap3 Interaction between SEP3 and AP3 proteins 666275 N/A 666281 unspecified role unspecified role prey prey N/A 666279 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The AP3 protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep3-pi Interaction between SEP3 and PISTALLATA1 (PI) proteins 666275 N/A 666282 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 666281 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 and Figure 4 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-pi-1 Interaction between SEP2 and PISTALLATA1 (PI) proteins 666275 N/A 666280 unspecified role unspecified role prey prey N/A 666282 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-pi Interaction between SEP1 and PISTALLATA1 (PI) proteins 666275 N/A 666282 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 666278 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 and Figure 4 The PISTALLATA1 (P1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-ap1 Interaction between SEP2 and APETALA 1 (AP1) proteins 666275 N/A 666280 unspecified role unspecified role prey prey N/A 666283 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. The authors state that this interaction was judged to be very weak , slightly above background levels. sep3-ap1-1 Interaction between SEP3 and APETALA 1 (AP1) proteins 666275 N/A 666281 unspecified role unspecified role prey prey N/A 666283 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. This interaction was judged to be weak by the authors sep3-ag-1 Interaction between SEP3 and AGAMOUS (AG) proteins 666275 N/A 666284 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 666281 unspecified role unspecified role prey prey physical association physical association false false false 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep2-ag-1 Interaction between SEP2 and AGAMOUS (AG) proteins 666275 N/A 666280 unspecified role unspecified role prey prey N/A 666284 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-ag-2 Interaction between SEP1 and AGAMOUS (AG) proteins 666275 N/A 666284 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 666278 unspecified role unspecified role prey prey physical association physical association false false false 2 The AGAMOUS(AG) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep1-ap1-1 Interaction between SEP1 and APETALA 1 (AP1) proteins 666275 N/A 666283 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 666278 unspecified role unspecified role prey prey physical association physical association false false false 2 The APETALA 3 (AP3) protein used in this study had the MADS box region deleted. The authors do not give coordinates for the deletion within the protein so the region described as the MADS box region in the UniProt entry for the protein is provided as 'fuzzy coordinates'. Fuzzy coordinates are used to describe a region in a protein where the exact coordinates are uncertain. sep3-pi-1 Interaction between SEP3 and PISTALLATA1 (PI) proteins 666275 N/A 666282 unspecified role unspecified role prey prey P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile142Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ala154Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu87Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu103Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gln102Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly110Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu116Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Asn149Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu160Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gln167Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly177Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Met153Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 666281 unspecified role unspecified role bait bait O22456:p.Arg146Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3 Figure 5 Mutations Gln102Pro and Gly110Pro only slightly reduced affinity for the P1 protein for the SEP3 protein. Unfortunately this cannot be quantified since the value for each is not provided, but it appears to be a reduction in value comapred to wild type PI affinity for SEP3 of less than 5% (percent). pi-ap3 Interaction between PI and AP3 proteins 666275 N/A 666282 unspecified role unspecified role bait bait P48007:p.Asn149Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu160Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gln167Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly177Pro mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu87Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gln102Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu103Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly110Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu116Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile142Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile91Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Asn98Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu101Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu105His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu116Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu108Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly110Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu121Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Val124Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile128Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Val135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile94Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Met153Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Gly131Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ala154Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 666279 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 and Figure 4 sep1-ap1-2 Interaction between SEP1 and APETALA 1 (AP1) proteins 666275 N/A 666283 unspecified role unspecified role bait bait N/A 666278 unspecified role unspecified role prey prey physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. ap1-sep2 Interaction between SEP2 and APETALA 1 (AP1) proteins 666275 N/A 666283 unspecified role unspecified role prey prey N/A 666280 unspecified role unspecified role bait bait physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry In summary, these results demonstrate that SEP1, SEP2, and SEP3 are capable of interacting in yeast two-hybrid assays with several MADS proteins including AP3, PI, AP1 and AG. ap1-sep3-3 Interaction between SEP3 and APETALA 1 (AP1) proteins 666275 N/A 666281 unspecified role unspecified role prey prey N/A 666283 unspecified role unspecified role bait bait physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. ap1 APETALA 1 (AP1) homodimer 666275 N/A 666283 unspecified role unspecified role prey prey N/A 666283 unspecified role unspecified role bait bait physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. ap3-sep3 Interaction between SEP3 and AP3 proteins 666275 N/A 666281 unspecified role unspecified role prey prey N/A 666279 unspecified role unspecified role bait bait physical association physical association false false false 2 The APETALA 1 (AP1) protein used in this study had the MADS box region and I box domain deleted. The authors do not give coordinates for the deletion within the protein and so this information cannot be presented in this entry. sep1-ap3-p1 Yeast three hybrid analysis of the AP3/PI/SEP1 ternary complex 666276 N/A 666282 unspecified role unspecified role prey prey P48007:p.Leu121Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ser145Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 666278 unspecified role unspecified role prey prey N/A 666279 unspecified role unspecified role bait bait physical association physical association false false false Figure 3C sep3-pi-3 Interaction between SEP3 and PISTALLATA1 (PI) proteins 666277 N/A 666281 unspecified role unspecified role bait bait N/A 666282 unspecified role unspecified role prey prey P48007:p.Leu121Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ala127Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.[Glu129Lys;Leu132Pro] glu129lys-lys132pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile142Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.[Ala154Pro;Gln157Glu;Phe162Leu] ala154pro-gln157glu-phe162leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Leu116Pro;Met152Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Asn89Ser;Met152Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Asp99Gly;Gln199Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Arg158Gln;Glu168Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.Pro193Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.[Glu141Arg;Pro193Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Asp112Gly;Arg176Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Leu118Pro;Asn149Asp;Leu160Pro] leu118pro-asn149asp-leu160pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Leu105Pro;Asp112Ala;Glu125Gly;Val206Ala] leu105pro-asp112ala-glu125gly-val206ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.Glu125Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Val124Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile128Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Ile128Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Glu129Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Lys151Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu164Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.[Phe162Leu;Met203Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Met122Lys;Glu141Lys;Met178Val] met122lys-glu141lys-met178val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.[Ser115Phe;Lys119Ile;Asn120Ile] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu143Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P48007:p.Leu132Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1