IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pan-2004-2 ARPC1/Arc40 mediates the interaction of the actin-related protein 2 and 3 complex with Wiskott-Aldrich syndrome protein family activators. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pan F., Egile C., Lipkin T., Li R. rli@hms.harvard.edu J. Biol. Chem. (0021-9258) 2004 pan-2004-4 ARPC1/Arc40 mediates the interaction of the actin-related protein 2 and 3 complex with Wiskott-Aldrich syndrome protein family activators. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pan F., Egile C., Lipkin T., Li R. rli@hms.harvard.edu J. Biol. Chem. (0021-9258) 2004 pan-2004-1 ARPC1/Arc40 mediates the interaction of the actin-related protein 2 and 3 complex with Wiskott-Aldrich syndrome protein family activators. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Pan F., Egile C., Lipkin T., Li R. rli@hms.harvard.edu J. Biol. Chem. (0021-9258) 2004 pan-2004-3 ARPC1/Arc40 mediates the interaction of the actin-related protein 2 and 3 complex with Wiskott-Aldrich syndrome protein family activators. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Pan F., Egile C., Lipkin T., Li R. rli@hms.harvard.edu J. Biol. Chem. (0021-9258) 2004 arpc1_yeast Actin-related protein 2/3 complex subunit 1 ARC40 YBR234C YBR1532 Arp2/3 complex 41 kDa subunit p41-ARC protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFSNSKDKSVVAVYKLVKAPIYSHCFSQDKSILAVTCETDCLVYRVSNNTPPVLFATLKDHDKTITAVDISIHGRIVTCSQDRNAYVWEPLSDGTYKPTLVLLRINRAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHANGVLLAAGGTDGFMRVFSGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQGSYIHDVEWRSQMERIAYVAHDGTLNVVDYQSPVQSVNAPEGLPYRSLVWINDHEIVCGGYSCHPVLFSEASEGWKFAKNLDKSDNNKSSALTASGNTDELSGNNDESSTFGISALRKFKELDLKGKVSTDVQESAHENAIVELRPFAESNGQITQVSSCGLDGKIVIYTI D75C6BB8EC35EEDF las17_yeast Proline-rich protein LAS17 LAS17 YOR181W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLLNSSDKEIIKRALPKASNKIIDVTVARLYIAYPDKNEWQYTGLSGALALVDDLVGNTFFLKLVDINGHRGVIWDQELYVNFEYYQDRTFFHTFEMEECFAGLLFVDINEASHFLKRVQKRERYANRKTLLNKNAVALTKKVREEQKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFSDINSTTASAPTTPAPALPPASPEVRKEETHPKHSLPPLPNQFAPLPDPPQHNSPPQNNAPSQPQSNPFPFPIPEIPSTQSATNPFPFPVPQQQFNQAPSMGIPQQNRPLPQLPNRNNRPVPPPPPMRTTTEGSGVRLPAPPPPPRRGPAPPPPPHRHVTSNTLNSAGGNSLLPQATGRRGPAPPPPPRASRPTPNVTMQQNPQQYNNSNRPFGYQTNSNMSSPPPPPVTTFNTLTPQMTAATGQPAVPLPQNTQAPSQATNVPVAPPPPPASLGQSQIPQSAPSAPIPPTLPSTTSAAPPPPPAFLTQQPQSGGAPAPPPPPQMPATSTSGGGSFAETTGDAGRDALLASIRGAGGIGALRKVDKSQLDKPSVLLQEARGESASPPAAAGNGGTPGGPPASLADALAAALNKRKTKVGAHDDMDNGDDW 4488355563AA2645 myo5_yeast Myosin-5 MYO5 YMR109W YM9718.08 Class I unconventional myosin MYO5 Type I myosin MYO5 Actin-dependent myosin-I MYO5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAILKRGARKKVHQEPAKRSANIKKATFDSSKKKEVGVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDRESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRRIDAATKIQRTIRERKEGNKYEKLRDYGTKVLGGRKERRSMSLLGYRAFMGDYLSCNESKSKGAYIKRQVSIKEKVIFSIHGEALHTKFGRSAQRLKKTFLLTPTTLYIVGQTLVQNAMTYTQDYKIDVRNIQAVSLTNLQDDWVAIKLASSGQPDPLINTYFKTELITHLKRLNDKIQIKIGSAIEYQKKPGKLHSVKCQINESAPKYGDIYKSSTISVRRGNPPNSQVHKKPRKKSSISSGYHASSSQATRRPVSIAAAQHVPTAPASRHSKKPAPPPPGMQNKAATRRSVPNPASTLTASQSNARPSPPTAATRATPAATPAAAAMGSGRQANIPPPPPPPPPSSKPKEPMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYMKPHSGNNNIPTPPQNRDVPKPVLNSVQHDNTSANVIPAAAQASLGDGLANALAARANKMRLESDDEEANEDEEEDDW DFFB9EC16B61CD29 wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED arp3_yeast Actin-related protein 3 ARP3 ACT4 YJR065C J1760 Actin-like protein ARP3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRNFSLFNMV 5BBD87E83F476E9F arp2_yeast Actin-related protein 2 ACT2 YDL029W D2778 ARP2 Actin-like protein ARP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGPSAMTKFGPR 4C9E8952B477A1B9 arpc5_yeast Actin-related protein 2/3 complex subunit 5 ARC15 Arp2/3 complex 16 kDa subunit YIL062C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEADWRRIDIDAFDPESGRLTAADLVPPYETTVTLQELQPRMNQLRSLATSGDSLGAVQLLTTDPPYSADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQRDVLVKYLYKGMSVPQGQKQGGVLLAWLERITQVSGVTPIVHYISDRRTV 10E4DAF0F0801B02 arpc3_yeast Actin-related protein 2/3 complex subunit 3 ARC18 YLR370C L8039.15 Arp2/3 complex 21 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MPAYHSTFPVDPNTDRMVGNFALLPLNTKFRGPAYPSNSDYDIIDECLDLFRANSFFKNFEIKSPADRVLIYGILFINDCLAHLKITTSFNEAVKVLTNVALDNFTLPGTPGFPLNNVYQVPVQDHNSMDLLKTYIQQFRQELAMRLLERVYSSTDSKEYPSKFWLAFTRRRFMNKSL 456EABC2B9CC4860 las17-arc40-1 Interaction between LAS17 and Arc40 identified by pulldown 606996 N/A 607000 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 607001 unspecified role unspecified role bait bait vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3A Bait protein: Bee1; arc40-myo5-1 Interaction between Myo5 and Arc40 identified by pulldown 606996 N/A 607002 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 607000 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 3A arc40-wsp-1 Interaction between Wsp1 and Arc40 identified by pulldown 606996 N/A 607003 unspecified role unspecified role bait bait O00401:p.Trp503Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) N/A 607000 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 3A, 3B arp3-wsp-1 Interaction between Wsp1 and Arp3 complex identified by pulldown 606997 N/A 607004 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 607003 unspecified role unspecified role bait bait O00401:p.Trp503Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3A,6A WASP1 incubated with entire isolated Arp2/3 complex but only Arp3 identified by western blot. Isolation of the complex from Arc40 deficient cells indicated that loss of Arc40 strongly reduced the affinity of VCA with the Arp2/3 complex. The use of Arp2 deficient cells suggested that lack of Arp2 had only a slight effect on the interaction between Arp2/3 complex with VCA and that that ARPC1/Arc40 mediates a major interaction between the Arp2/3 complex and VCA. arp2-wsp-2 Interaction between Wsp1 and Arp2 complex identified by pulldown 606997 N/A 607003 unspecified role unspecified role bait bait O00401:p.Trp503Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) N/A 607005 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 6B, 6C WASP1 incubated with entire isolated Arp2/3 complex but only Arp2 identified by western blot. Isolation of the complex from Arc40 deficient cells indicated that loss of Arc40 strongly reduced the affinity of VCA with the Arp2/3 complex. The use of Arp2 deficient cells suggested that lack of Arp2 and Arp3 had only a slight effect on the interaction between Arp2/3 complex with VCA and that that ARPC1/Arc40 mediates a major interaction between the Arp2/3 complex and VCA. arp3-arc40-1 Interaction between Arp3 and Arc40 identified by TAP 606998 N/A 607000 unspecified role unspecified role prey prey N/A 607004 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 arp2-arp3-2 Components of the Arp2/3 complex identified by gel filtration 606999 N/A 607006 unspecified role unspecified role neutral component neutral component N/A 607007 unspecified role unspecified role neutral component neutral component N/A 607004 unspecified role unspecified role neutral component neutral component N/A 607005 unspecified role unspecified role neutral component neutral component physical association physical association false false false 5 Complexes forms in strains in which Arc40 has been deleted, but Arp2 is less strongly associated within it.