IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ apcher-2004-2 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk FEBS Lett. (0014-5793) 2004 apcher-2004-1 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk FEBS Lett. (0014-5793) 2004 apcher-2004-3 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk FEBS Lett. (0014-5793) 2004 apcher-2004-4 The alpha4 and alpha7 subunits and assembly of the 20S proteasome. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Apcher GS., Maitland J., Dawson S., Sheppard P., Mayer RJ. john.mayer@nottingham.ac.uk FEBS Lett. (0014-5793) 2004 psa7_human Proteasome subunit alpha type-7 PSMA7 Proteasome subunit RC6-1 Proteasome subunit XAPC7 HSPC protein protein human Homo sapiens Human MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS psa1_human Proteasome subunit alpha type-1 PSMA1 PROS30 PSC2 Proteasome component C2 Macropain subunit C2 Multicatalytic endopeptidase complex subunit C2 Proteasome nu chain 30 kDa prosomal protein HC2 NU protein protein human Homo sapiens Human MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH psa3_human Proteasome subunit alpha type-3 PSMA3 PSC8 Proteasome component C8 Macropain subunit C8 Multicatalytic endopeptidase complex subunit C8 HC8 protein protein human Homo sapiens Human MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM psa4_human Proteasome subunit alpha type-4 PSMA4 PSC9 Proteasome component C9 Macropain subunit C9 Multicatalytic endopeptidase complex subunit C9 Proteasome subunit L HC9 protein protein human Homo sapiens Human MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK psa6_human Proteasome subunit alpha type-6 PSMA6 PROS27 Proteasome iota chain Macropain iota chain Multicatalytic endopeptidase complex iota chain 27 kDa prosomal protein protein protein human Homo sapiens Human MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD psa5_human Proteasome subunit alpha type-5 PSMA5 Proteasome zeta chain Macropain zeta chain Multicatalytic endopeptidase complex zeta chain protein protein human Homo sapiens Human MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI psa2_human Proteasome subunit alpha type-2 PSMA2 PSC3 Proteasome component C3 Macropain subunit C3 Multicatalytic endopeptidase complex subunit C3 HC3 protein protein human Homo sapiens Human MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA alpha7-alpha1-1 GST pulldown reveals interaction between the proteasome subunits alpha 7 and alpha 1 662972 N/A 662976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662977 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 alpha7-alpha3 GST pulldown reveals interaction between the proteasome subunits alpha 7 and alpha 3 662972 N/A 662976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662978 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha4-1 GST pulldown reveals interaction between the proteasome subunits alpha 7 and alpha 4 662972 N/A 662976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662979 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 3 alpha7-alpha6-2 GST pulldown reveals interaction between the proteasome subunits alpha 7 and alpha 6 662972 N/A 662976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662980 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 Fig. 2A, panel i shows that in vitro translated α7 binds the six other GST-α subunits and itself, confirming the result of the Y2H screen alpha7-alpha7-1 GST pulldown analysis reveals homotypic interaction between alpha 7 protein of the 20S Proteasome 662972 N/A 662976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 3 alpha6-alpha4 GST pulldown analysis reveals interaction between the proteasome subunits alpha 6 and alpha 4 662972 N/A 662979 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 662980 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 alpha6-alpha7-2 GST pulldown analysis reveals interaction between the proteasome subunits alpha 6 and alpha 7 662972 N/A 662980 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 3 alpha5-alpha4 GST pulldown analysis reveals interaction between the proteasome subunits alpha 5 and alpha 4 662972 N/A 662979 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 662981 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 alpha5-alpha7 GST pulldown analysis reveals interaction between the proteasome subunits alpha 5 and alpha 7 662972 N/A 662981 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 3 alpha4-alpha3-1 GST pulldown analysis reveals interaction between the proteasome subunits alpha 4 and alpha 3 662972 N/A 662978 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 662979 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 2 alpha4-alpha4 GST pulldown analysis reveals interaction between the proteasome subunits alpha 4 and alpha 4 662972 N/A 662979 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 662979 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 alpha4-alpha7-2 GST pulldown analysis reveals interaction between the proteasome subunits alpha 4 and alpha 7 662972 N/A 662979 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3 alpha3-alpha4-2 GST pulldown analysis reveals interaction between the proteasome subunits alpha 3 and alpha 4 662972 N/A 662978 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662979 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3 alpha3-alpha7-1 GST pulldown analysis reveals interaction between the proteasome subunits alpha 3 and alpha7 662972 N/A 662978 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3 alpha2-alpha7-1 GST pulldown analysis reveals interaction between the proteasome subunits alpha 2 and alpha7 662972 N/A 662976 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 662982 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3 alpha2-alpha4-2 GST pulldown analysis reveals interaction between the proteasome subunits alpha 2 and alpha4 662972 N/A 662979 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 662982 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 alpha1-alpha7-2 GST pulldown analysis reveals interaction between the proteasome subunits alpha 1 and alpha7 662972 N/A 662977 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662976 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 2 alpha1-alpha4-1 GST pulldown analysis reveals interaction between the proteasome subunits alpha 1 and alpha4 662972 N/A 662977 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 662979 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3 alpha2-alpha4-1 Yeast 2 hybrid analysis reveals interaction between alpha 2 protein and the alpha4 protein of the 20S Proteasome 662973 N/A 662982 unspecified role unspecified role bait bait N/A 662979 unspecified role unspecified role prey prey physical association physical association false false false 1 alpha2-alpha7 Yeast 2 hybrid analysis reveals interaction between alpha 2 protein and the alpha7 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role prey prey N/A 662982 unspecified role unspecified role bait bait physical association physical association false false false 1 alpha7-alpha6-1 Yeast 2 hybrid analysis reveals interaction between alpha 7 protein and the alpha6 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role bait bait N/A 662980 unspecified role unspecified role prey prey physical association physical association false false false 1 alpha7-alpha7 Yeast 2 hybrid analysis reveals homotypic interaction between alpha 7 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role bait bait N/A 662976 unspecified role unspecified role prey prey physical association physical association false false false 1 alpha6-alpha7-1 Yeast 2 hybrid analysis revealsinteraction between alpha 6 protein and alpha 7 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role prey prey N/A 662980 unspecified role unspecified role bait bait physical association physical association false false false 1 alpha4-alpha7-1 Yeast 2 hybrid analysis revealsinteraction between alpha 4 protein and alpha 7 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role prey prey N/A 662979 unspecified role unspecified role bait bait physical association physical association false false false 1 alpha3-alpha7 Yeast 2 hybrid analysis revealsinteraction between alpha 3 protein and alpha 7 protein of the 20S Proteasome 662973 N/A 662978 unspecified role unspecified role bait bait N/A 662976 unspecified role unspecified role prey prey physical association physical association false false false 1 alpha1-alpha7-1 Yeast 2 hybrid analysis revealsinteraction between alpha 31 protein and alpha 7 protein of the 20S Proteasome 662973 N/A 662976 unspecified role unspecified role prey prey N/A 662977 unspecified role unspecified role bait bait physical association physical association false false false 1 alpha1-alpha2-2 The alpha subunits of the 20S proteasome 662974 N/A 662981 unspecified role unspecified role neutral component neutral component N/A 662982 unspecified role unspecified role neutral component neutral component N/A 662980 unspecified role unspecified role neutral component neutral component N/A 662978 unspecified role unspecified role neutral component neutral component N/A 662976 unspecified role unspecified role neutral component neutral component N/A 662977 unspecified role unspecified role neutral component neutral component N/A 662979 unspecified role unspecified role neutral component neutral component physical association physical association false false false 4 alpha4-alpha7-3 Coip analysis reveals interaction between the proteasome subunits alpha 4 and alpha 7 662975 N/A 662979 unspecified role unspecified role bait bait N/A 662976 unspecified role unspecified role prey prey physical association physical association false false false 5