IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fritze-2004-1 The crystal structures of Zea mays and Arabidopsis 4-hydroxyphenylpyruvate dioxygenase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fritze IM., Linden L., Freigang J., Auerbach G., Huber R., Steinbacher S. fritze@biochem.mpg.de Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation hppd_arath 4-hydroxyphenylpyruvate dioxygenase HPD 4-hydroxyphenylpyruvic acid oxidase PDS1 F12K11.9 At1g06570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGHQNAAVSENQNHDDGAASSPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG hpd_maize_protein 4-hydroxyphenylpyruvate dioxygenase from Zea mays protein protein maize Zea mays (Maize) Maize An amino acid sequence which is not represented in UniProt iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hpd-1 Homodimerisation of HPD demonstrated by X-ray crystallography 607568 N/A 607569 unspecified role unspecified role neutral component neutral component gly-ser-his tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 direct interaction direct interaction false false false 3.00A working 23.7%, free 31.2% hpd-2 Homodimerisation of HPD demonstrated by X-ray crystallography 607568 N/A 607570 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 607571 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 2.00A working 27.5%, free 32.4%