IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ muhlenbein-2004-1 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muhlenbein N., Hofmann S., Rothbauer U., Bauer MF. Apoptosis - Interactions involving proteins with a function related to apoptosis Mitochondrion lysed with 0.5% digitonin bauer@bio.med.uni-muenchen.de J. Biol. Chem. (0021-9258) 2004 muhlenbein-2004-2 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Muhlenbein N., Hofmann S., Rothbauer U., Bauer MF. Apoptosis - Interactions involving proteins with a function related to apoptosis Mitochondrion lysed with 0.5% digitonin bauer@bio.med.uni-muenchen.de J. Biol. Chem. (0021-9258) 2004 muhlenbein-2004-3 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Muhlenbein N., Hofmann S., Rothbauer U., Bauer MF. Apoptosis - Interactions involving proteins with a function related to apoptosis Mitochondrion lysed with 0.5% digitonin bauer@bio.med.uni-muenchen.de J. Biol. Chem. (0021-9258) 2004 t10b_human Mitochondrial import inner membrane translocase subunit Tim10 B TIMM10B FXC1 Fracture callus protein 1 FxC1 Mitochondrial import inner membrane translocase subunit Tim9 B TIM9B TIMM10B TIMM9B protein protein human Homo sapiens Human MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS tim9_human Mitochondrial import inner membrane translocase subunit Tim9 TIMM9 TIM9 TIM9A TIMM9A protein protein human Homo sapiens Human MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR tim10_human Mitochondrial import inner membrane translocase subunit Tim10 TIMM10 TIM10 protein protein human Homo sapiens Human MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA tim22_human Mitochondrial import inner membrane translocase subunit Tim22 TIMM22 TEX4 TIM22 Testis-expressed protein 4 protein protein human Homo sapiens Human MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR adt3_human ADP/ATP translocase 3 SLC25A6 ANT3 CDABP0051 Adenine nucleotide translocator 3 ADP,ATP carrier protein 3 Solute carrier family 25 member 6 ADP,ATP carrier protein, isoform T2 AAC3 protein protein human Homo sapiens Human MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI tim9_mouse Mitochondrial import inner membrane translocase subunit Tim9 Timm9 Tim9 Tim9a Timm9a protein protein mouse Mus musculus Mouse MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEEVTCSEHCLQKYLKMTQRISVRFQEYHIQQNEALAAKAGLLGQPR tim10_mouse Mitochondrial import inner membrane translocase subunit Tim10 Timm10 Tim10 protein protein mouse Mus musculus Mouse MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA timm9-timm10-1 Interaction between TIMM9, TIMM10 and FCX1 identified by coimmunoprecipitation 592333 N/A 592336 unspecified role unspecified role prey prey N/A 592337 unspecified role unspecified role bait bait N/A 592338 unspecified role unspecified role prey prey association association false false false 2 timm9-timm10-2 Interaction between TIMM9, TIMM10 and FCX1 identified by coimmunoprecipitation 592333 N/A 592336 unspecified role unspecified role bait bait N/A 592337 unspecified role unspecified role prey prey N/A 592338 unspecified role unspecified role prey prey association association false false false 2 timm9-timm10-3 Interaction between TIMM9, TIMM10 and FCX1 identified by coimmunoprecipitation 592333 N/A 592337 unspecified role unspecified role prey prey N/A 592336 unspecified role unspecified role prey prey N/A 592338 unspecified role unspecified role bait bait association association false false false 2 timm9-timm10-6 Interaction between TIMM9, TIMM10, TIMM22 and FCX1 identified by coimmunoprecipitation 592333 N/A 592337 unspecified role unspecified role bait bait N/A 592339 unspecified role unspecified role prey prey N/A 592336 unspecified role unspecified role prey prey N/A 592338 unspecified role unspecified role prey prey association association false false false 4 timm9-timm10-7 Interaction between TIMM9, TIMM10, TIMM22 and FCX1 identified by coimmunoprecipitation 592333 N/A 592336 unspecified role unspecified role bait bait N/A 592339 unspecified role unspecified role prey prey N/A 592337 unspecified role unspecified role prey prey N/A 592338 unspecified role unspecified role prey prey association association false false false 4 timm9-timm10-8 Interaction between TIMM9, TIMM10, TIMM22 and FCX1 identified by coimmunoprecipitation 592333 N/A 592339 unspecified role unspecified role bait bait N/A 592337 unspecified role unspecified role prey prey N/A 592336 unspecified role unspecified role prey prey N/A 592338 unspecified role unspecified role prey prey association association false false false 4 timm9-timm10-4 Interaction between TIMM9, TIMM10 and FCX1 identified by gel filtration 592334 N/A 592337 unspecified role unspecified role neutral component neutral component N/A 592336 unspecified role unspecified role neutral component neutral component N/A 592338 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3 Molecular weight = 450kDa timm9-timm10-5 Interaction between TIMM9 and TIMM10 identified by gel filtration 592334 N/A 592337 unspecified role unspecified role neutral component neutral component N/A 592338 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3 Molecular weight = 70kDa timm9-slc25a6-1 Interaction between TIMM9 and SLC25A6 identified by chemical crosslinking 592335 N/A 592340 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 592341 unspecified role unspecified role neutral component neutral component mouse-liver Mus musculus liver liver physical association physical association false false false 5 timm10-slc25a6-2 Interaction between TIMM9 and SLC25A6 identified by chemical crosslinking 592335 N/A 592342 unspecified role unspecified role neutral component neutral component mouse-liver Mus musculus liver liver N/A 592340 unspecified role unspecified role neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 5