IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hong-2003-1 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation hong-2003-2 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation hong-2003-3 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. in vitro In vitro pull down pull down autoradiography autoradiography Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation hong-2003-4 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation hong-2003-5 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation hong-2003-6 p80 coilin, a coiled body-specific protein, interacts with ataxin-1, the SCA1 gene product. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Hong S., Ka S., Kim S., Park Y., Kang S. skang@korea.ac.kr Human brain cDNA library Biochim. Biophys. Acta (0006-3002) 2003 Only protein-protein interactions imex curation coil_human Coilin COIL CLN80 p80-coilin protein protein human Homo sapiens Human MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA p54253-1 Ataxin-1 ATXN1 ATX1 SCA1 Spinocerebellar ataxia type 1 protein protein protein human Homo sapiens Human MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRHGPAGTSVELGLQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQYAHLPHTFQFIGSSQYSGTYASFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTLLANMGSLSQTPGHKAEQQQQQQQQQQQQHQHQQQQQQQQQQQQQQHLSRAPGLITPGSPPPAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHTLTLGPPSQVVMQYADSGSHFVPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGKSVPHPYESRHVVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLGKPGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLPQHLVIPGTQPLLIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVTQAAYPAMVQAQIHLPVVQSVASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQPVDPASVLLKHSKADGLAGSRHRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPESRKLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK atxn1-coilin-1 Interaction between human ataxin-1 and coilin detected by Y2H 684285 N/A 684291 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 684292 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A atxn1-coilin-2 Interaction between human ataxin-1 and coilin detected by Y2H 684286 N/A 684291 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 684292 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 684302 684300 physical association physical association false false false 1B, 2B and 3B atxn1-coilin-3 Interaction between human ataxin-1 and coilin detected by pulldown 684287 N/A 684291 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 684292 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2C atxn1-coilin-4 Interaction between human ataxin-1 and coilin detected by coIP 684288 N/A 684291 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false xpress tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 684292 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2D atxn1-coilin-5 Interaction between human ataxin-1 and coilin detected by coIP 684289 N/A 684291 unspecified role unspecified role prey prey xpress tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 684292 unspecified role unspecified role bait bait physical association physical association false false false 3A atxn1-coilin-6 Colocalization of human ataxin-1 and coilin 684290 N/A 684292 unspecified role unspecified role neutral component neutral component N/A 684291 unspecified role unspecified role neutral component neutral component xpress tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5