IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ seibert-2002-1 Combinatorial diversity of fission yeast SCF ubiquitin ligases by homo- and heterooligomeric assemblies of the F-box proteins Pop1p and Pop2p. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seibert V., Prohl C., Schoultz I., Rhee E., Lopez R., Abderazzaq K., Zhou C., Wolf DA. This experiment used temperature-sensitive mutant cells (cdc25-22) which were arrested in G2 by incubation at 37C for 4 hours and then released into mitosis and subsequent cell cycle phases by rapidly shifting to 25C. dwolf@hsph.harvard.edu BMC Biochem. 2002 seibert-2002-4 Combinatorial diversity of fission yeast SCF ubiquitin ligases by homo- and heterooligomeric assemblies of the F-box proteins Pop1p and Pop2p. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seibert V., Prohl C., Schoultz I., Rhee E., Lopez R., Abderazzaq K., Zhou C., Wolf DA. This experiment used temperature-sensitive mutant cells (cdc25-22) which were arrested in G2 by incubation at 37C for 4 hours and then released into mitosis and subsequent cell cycle phases by rapidly shifting to 25C. dwolf@hsph.harvard.edu BMC Biochem. 2002 seibert-2002-5 Combinatorial diversity of fission yeast SCF ubiquitin ligases by homo- and heterooligomeric assemblies of the F-box proteins Pop1p and Pop2p. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seibert V., Prohl C., Schoultz I., Rhee E., Lopez R., Abderazzaq K., Zhou C., Wolf DA. This experiment used temperature-sensitive mutant cells (cdc25-22) which were arrested in G2 by incubation at 37C for 4 hours and then released into mitosis and subsequent cell cycle phases by rapidly shifting to 25C. dwolf@hsph.harvard.edu BMC Biochem. 2002 seibert-2002-2 Combinatorial diversity of fission yeast SCF ubiquitin ligases by homo- and heterooligomeric assemblies of the F-box proteins Pop1p and Pop2p. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seibert V., Prohl C., Schoultz I., Rhee E., Lopez R., Abderazzaq K., Zhou C., Wolf DA. This experiment used temperature-sensitive mutant cells (cdc25-22) which were arrested in G2 by incubation at 37C for 4 hours and then released into mitosis and subsequent cell cycle phases by rapidly shifting to 25C. dwolf@hsph.harvard.edu BMC Biochem. 2002 seibert-2002-3 Combinatorial diversity of fission yeast SCF ubiquitin ligases by homo- and heterooligomeric assemblies of the F-box proteins Pop1p and Pop2p. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Seibert V., Prohl C., Schoultz I., Rhee E., Lopez R., Abderazzaq K., Zhou C., Wolf DA. This experiment used temperature-sensitive mutant cells (cdc25-22) which were arrested in G2 by incubation at 37C for 4 hours and then released into mitosis and subsequent cell cycle phases by rapidly shifting to 25C. dwolf@hsph.harvard.edu BMC Biochem. 2002 cul1_schpo Cullin-1 cul1 pcu1 SPAC17G6.12 Cell division control 53 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTLNTNDKDLPIVKKYDSLNGTWDFLKTGVSQIFERLDEGMTITKYMELYTAIHNYCADASKTITVDNFNDQTANVLGEALYNNLVLYLEEYLARLRKECISQTNHEEQLAAYAKYWTRFTTSARFINHLFGYLNRYWVKLKNRFTETLVYDIYTLCLVSWHHHVFSHIRDSLLQNLLYMFTKKRLYEPTDMKYVEVCVDSITSLSFDKTDMTKPNLSSYKTFFETNFIENTKNFYAKESSEYLASHSITDYLKKAEIRLAEEEELVRLYLHESTLKPLLEATEDVLIAQHEEVLHNDFARMLDQNCSEDIIRMYRLMSRTPNGLQPLRQTFEEFVKRSGFAAVAKIVPQVGGEADVDPKEYMEMLLSTYKASKELVNTAFHGDTDFTKSLDTAFRELVNRNVVCQRSSSRSPELLAKYADSILRKSNKNVDIDDVEDCLSSIIIIFRYVEDKDVFQNFYTKLLAKRLVNGTSNSQDAESSMLSKLKEVCGFEYTSKLQRMFQDISLSQEITEAFWQLPQSRAGNIDFSALVLGTSFWPLSPNNVNFHLPEELVPLYEGFQNYYYSCHNGRKLSWLFHLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLSTDFLTGILNIFLKAKVLLLGDNDKLGDPNSTYKINENFRMKKIRVQLNLPIRSEQKQESLETHKTIEEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDMLIEKEYLERQGRDEYIYLA rbx1_schpo RING-box protein pip1 pip1 SPAC23H4.18c Pop-interacting protein 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDEMQIDKKEVEIEQKPPRFEIKKWNAVALWQWDIVVDNCAICRNHIMDLCIECQANTDSAAAQECTVAWGTCNHAFHFHCISRWLNTRNVCPLDNREWEFQRYGH skp1_schpo Suppressor of kinetochore protein 1 skp1 psh1 sph1 SPBC409.05 P19/Skp1 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEINVPIPLPNVSSNVLRKVLEWCEHHKNDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR pop2_schpo WD repeat-containing protein pop2 Proteolysis factor sud1 pop2 sud1 SPAC4D7.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLSRCPTDNSSSRINSSVPLINSSSPATPPESFDPQVFPSSLIHGDNLLPQDDQIASDPRSESNSCNGNTSSSLPCTDSYQYPLKHSCTPSFLRKFNESIENVSYKCLDHSPPDSVPGDFSISLVPQRNFLYSHSSLPPKIISIDRNNRIKLDNSISSNSDNFPPSPKVDTSNTVSPGSKPISEDLEDLNLQSIVQTFEDLPEGIQSYAFFQLLRSCNRQSMRLLLNECEPLLKKDILSNLPFSIVQSILLNLDIHSFLSCRLVSPTWNRILDVHTSYWKHMFSLFGFQINENDWKYANPNLNRPPFLHNDQISDDYFPEIFKRHFLNRKRWLFPSIPPSHLSFPIHVPNFMITSLLLHKDRIITTSGSGTIQIHNAITGVLEARLEGHKEGVWAVKIHENTLVSGSIDKTVRVWNIEKAKCTHIFRGHISIIRCLEILVPSRLIRHGVEIVEPDQPYIVSGSRDHTLRVWKLPKNTDPPYLPDNTNSIDRWEKNPYFVHTLIGHTDSVRTISGYGDILVSGSYDSSIRIWRVSTGECLYHLRGHSLRIYSVLYEPERNICISGSMDKSIRVWDLSTGTCKYVLEGHDAFVTLLNVFQNRLISGSADSTIRIWDLNTGKPLMVLPSNSGYISSFVSDEHKIISGNDGSVKLWDVRTGKLLRFLLTDLTKIWHVDFDAMRCVAAVQRDDQAYLEVINFSGSRP pop1_schpo WD repeat-containing protein pop1 WD repeat-containing protein ste16 pop1 SPBC1718.01 SPBC2G2.18 ste16 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNEKKKDSLSVLDSNEFFGETTMVSPSIDVSSSPRPNVERFSPCSTKKDLLEGNNIMTRIPEELSRVSLQFDSKGSQQSMIFTNNRCLSDKENLENLQNLLYLHCDLNRPHLSCELPSEHREKCLKRRNSSLSSNLHANKRFLFNSQSDGNKKNETFPSTNYSNVFYPNNCDSKEVASETTFSLDAPNNSVNYSYFSPNLLGNDSKTRQSFPPHSSSSSHNSLHEPVIYDFSSENPSIHPSNHLSSQKNAVLKLAQLISSFEKLPESVRQYLLFHLLSRCGKHAVQNIHKILLPIFQKNFLTGFPAEITNLVLTHLDAPSLCAVSQVSHHWYKLVSSNEELWKSLFLKDGFFWDSIDSKIRTMCLEQSLSACAIMKRVYFRHFNLRERWLHAPEKIKRCSFPIHGVRLITKLQFDDDKIIVSTCSPRINIYDTKTGVLIRSLEEHEGDVWTFEYVGDTLVTGSTDRTVRVWDLRTGECKQVFYGHTSTIRCIKIVQGNQSTTDTDDVEKENRPASNDANSMPPYIISSSRDCTIRLWSLPCLDDPPFVNVNENPDQNNDFTSATTNPFYIRTLRGHTDSVREVACLGDLIVSASYDGTLRVWKASTGVCLHVLRGHVGRVYSVTINPSRQQCISAGTDAKIRIWNLESGELLQTLHGHSNLVSQVTFNQNILVSASAPPDTSLRVWDLNTGSCRDILKCPLGHIFFQHDESKVVSGSHSTLQLWDIRSGKLVRDLLTDLDIIWQVAYNENVCVAAVLRNNRFWIEVLEFGSTKSS rum1_schpo Cyclin-dependent kinase inhibitor rum1 rum1 SPBC32F12.09 p25-rum1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPSTPPMRGLCTPSTPESPGSFKGVIDASLEGNSSIMIDEIPESDLPAPQVSTFPPTPAKTPKKQLLPNLMLQDRSNSLERCMEEDREHNPFLSSSDNQLLSRKKRKPTPPPSDGLYYVFRGKRIKKSFRPGTDLSTFKPKLLFADSAPSSSSDNPTSSVDLNDYSQIGILPPNLNSIGNKMFSLKSRVPSSSSGSFVAPPPQMRLPAYSSPQKSRSNTKDENRHNLLR pip1-cul1 Coip showing interaction of pip1 with cul1, skp1, pop1 and pop2 577061 N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577067 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1A The antiserum to pip1 was able to precipitate all five SCF-POP subunits, however the precipitation with pop1 was the weakest. skp1-pip1-1 Coip showing interaction of skp1 with pip1. 577061 N/A 577067 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 1A The antiserum to skp1 (psh1) was able to precipitate pip1 weakly. pop1-pip1 Coip showing interaction of pop1 with pip1, cul1, skp1 and pop2 577061 N/A 577067 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1A The antiserum to pop1 was able to precipitate all five SCF-POP subunits, however the precipitation with pop2 was the strongest. pop2-pip1 Coip showing interaction of pop2 with pip1, cul1, skp1 and pop1. 577061 N/A 577067 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1A The antiserum to pop2 was able to precipitate all five SCF-POP subunits. cul1-pip1 Coip showing interaction of cul1 with pip1, skp1 and pop2 577061 N/A 577066 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577067 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1A The antiserum to cul1 was able to moderately precipitate pip1 and weakly precipitate skp1 and pop2. pip1-pop1 Coip showing interaction of pip1 with pop1, skp1and cul1 in a pop2 deleted strain. 577061 N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577067 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 7A The antiserum to pip1 was able to precipitate pop1 in a pop2 deleted strain and the presence of associated SCF components in this deleted strain were detected also suggesting the presence of an individual homooligomeric SCFPop1 complex in vivo. pip1-pop2 Coip showing interaction of pip1 with pop2, skp1and cul1 in a pop1 deleted strain. 577061 N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577067 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 7A The antiserum to pip1 was able to precipitate pop2 in a pop1 deleted strain and the presence of associated SCF components in this deleted strain were also detected suggesting the presence of an individual homooligomeric SCFPop2 complex in vivo. pop1-pop2 Coip showing interaction of pop1with pop2 mutants. 577062 N/A 577069 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 6A The Pop1p-Pop2p interaction occurs independently of the F-boxes of both Pop1p and Pop2p as observed by f-box deletion and f-box swap mutants (AA 304-344 in pop1 and 242-282 in pop2). pop2-pop1-1 Coip showing interaction of pop2with pop1 mutants. 577062 N/A 577069 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 6A The Pop1p-Pop2p interaction occurs independently of the F-boxes of both Pop1p and Pop2p as observed by f-box deletion and f-box swap mutants (AA 304-344 in pop1 and 242-282 in pop2). pop2-pop1-2 CoIP showing interaction of pop2 fragments with pop1 fragments. 577062 N/A 577069 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 6B The Pop1p-Pop2p interaction is mediated by their N-terminal domains. pip1-cul1-2 Coip showing interaction of pip1 with cul1 and skp1during the cell cycle. 577063 N/A 577067 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1C The antiserum to pip1 was able to precipitate the core SCF-POP components, cul1 and skp1 during the cell cycle at G2 phase. pop2-pop1 Coip showing interaction of pop2 with pop1during the cell cycle. 577063 N/A 577069 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false Figure 1C The antiserum to pop2 was able to precipitate pop1 during the cell cycle at G2 phase indicating heterooligomerization. pip1-cul1-1 Coip showing interaction of pip1 with cul1, skp1, pop1 and pop2 in a 500kDa complex. 577064 N/A 577066 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577067 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577068 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577070 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false Figure 1B The antiserum to pip1 was able to precipitate all five SCF-POP subunits of the 500kDa complex. rum1-pop1pop2 Pull-down showing binding of rum1 to a pop1/pop2 complex 577065 N/A 577070 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577069 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 577071 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false The pop1-pop2 complex specifically bound phosphorylated Rum1. Figure 2B