IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ meijsing-2001-2 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-3 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-5 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-1 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-4 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Interactions demonstrated in this experiment have been shown to be indirect. ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-6 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Interactions demonstrated in this experiment have been shown to be indirect. ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 meijsing-2001-7 The silencing complex SAS-I links histone acetylation to the assembly of repressed chromatin by CAF-I and Asf1 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Meijsing SH., Ehrenhofer-Murray AE. Chromatin - Epigenetic interactions resulting in chromatin modulation Sephacryl S-300 gel-filtration. ehrenhof@molgen.mpg.de Yeast cDNA Genes Dev. (0890-9369) 2001 sas5_yeast Something about silencing protein 5 SAS5 YOR213C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDHSIEVTFRVKTQQVIIPEQNIRGNELPLRRWQMELLMLDATGKEVEPTILSKCIYHLHSSFKQPKRRLNSLPFFIKETGWGEFNLKIECFFIGNAGKFSIEHDLTFEDDAYAVDYTVDVPHEFSHLNSELSKYFDLPWKVVSPEEEMSLRIADLPWIKSLALIDEDMMTDVVQMILNDPAVQRAIENHPRREQFFMFITQLPDDLLMKIQAFLKLPNKNSTKQERTNFGSDAIHKDEPVKAHNKLK sas4_yeast Something about silencing protein 4 SAS4 YD9395.15C YDR181C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIFQSIEEANNTSERLLRSEIKNSHGEFEKFDFDTEEYEINPKRKLRLVSRINPNAGHLRKSKSCFTVDEHVDETRCQKPVMKSPFMSNVDDEIKKKRETITKMTLEIEHHELSQNIRKPTDDLLPDSTYQPYHKKMLKQENRMIQSDIVNGENEADRLSLISDRLGMLNWEVTLQKVTKINDPTDENEMETKRYQTKELIDSMLHKFESMKKKSRNLARRPASSDSLLKLVSGKDWPKIYTRIDRTFIPDYASSSDEEEEKITVEEIRERRLKKREQQCGGSIIVLLSDHQSQKGMTRFAIVAEPLRKPYLIKTSTKERNSWKNKVPTNPKKFKKAPRISTQIAVKRRREVIPLTMEVEPEVIRDIRQDTQKSMKLNVKAEEISVTETVKSKEMNALRNNAASISPTLSEKAPLGSISSCTASQISQRSSENVGAIINNINPNLAIVPSCNEKTFVKTHNGMKTNSGINILPVRKKKKV sas2_yeast Histone acetyltransferase SAS2 SAS2 ESO1 YMR127C YM9553.03C Something about silencing protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARSLSQSLTATTQKLKGKKNGGKGKNKPSAKIKKTQKEMLYGILNERNIRQIQFGLNKKFSTWYGSAVYFDPETKRLGCSETKGQLSSVSNSQYWLDTLFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTKLYLDNKSMYFKVDHYEFYIVYETGSTKPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLIEFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDLSIVTGMRVNDVILTLKHLNCIGENNQIYLQSLNSWLKLHGTKRNWFKLKDEYLLIDD rlf2_yeast Chromatin assembly factor 1 subunit p90 RLF2 CAC1 YPR018W YP9531.12 CAF-1 90 kDa subunit RAP1 localization factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQHLKSIPLQDDTKKKGILSFFQNTTTVKSNKFLTKEKDVITLDDPKEDVSGPMIETVKQETMKSINKECADEMKTTPKKANAEDKLLCYKNSPIQSTKYDRNTNKQVPNGNIIAIETKSRSSSPCSKRELSSSKKEEAKREKELKKQQRAEEKHRKELLRQEEKKKKELKVEEERQRRAELKKQKEEEKRRKEEARLEAKRRKEEERLKKEEEIRLKEEAKERAQSRIGNFFKKLSDSNTPVVEKSDYEKFFLPFYAKDGVRVSNKWKLTKVELEGSKRKIDDELLNSKDKTSSDDLLNWLQSRRLPRGHKIKRKAVDVLQQMPLKEKTDDELQSLLAQVPHKYIKFYENVRPPFIGTYSMDFTLPPNDPFSTKGTGFNYDYDSDVEWVNEEEEGEVDNLESGEEEEEEEDDEDVPSEGEFDGFLDSEENSDLDGLPCAKRKFVGPLIPTICLKSNFENLSEENKRYLQQLKAEVIIETDGPIDPFKEPKTSSLPSKRSNSDLQAQTASQSQSPEKKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAIRSSGKGDLPRKWVIKDAQNWENLRANANMPTPSL C593E6E4FE5FD778 asf1_yeast Histone chaperone ASF1 ASF1 YJL115W J0755 CIA1 Anti-silencing function protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEEDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGEEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN 186E76075C0B1644 sas4-sas5-1 Interaction between SAS4 and SAS5 identified by Y2H 608398 N/A 608405 unspecified role unspecified role bait bait N/A 608406 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas2-sas4-2 Interaction between SAS2 and SAS4 identified by Y2H 608398 N/A 608406 unspecified role unspecified role prey prey N/A 608407 unspecified role unspecified role bait bait P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P40963:p.Pro213_Pro214delinsAlaVal HAT domain disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 sas2-sas4-3 Interaction between SAS2 and SAS4 identified by Y2H 608398 N/A 608407 unspecified role unspecified role prey prey N/A 608406 unspecified role unspecified role bait bait physical association physical association false false false Table 1 sas2-sas2-1 Homodimerisation of SAS2 identified by Y2H 608398 N/A 608407 unspecified role unspecified role prey prey N/A 608407 unspecified role unspecified role bait bait physical association physical association false false false Table 1 sas2-cac1-1 Interaction between SAS2 and CAC1 identified by Y2H 608398 N/A 608408 unspecified role unspecified role prey prey N/A 608407 unspecified role unspecified role bait bait P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P40963:p.Pro213_Pro214delinsAlaVal HAT domain disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 sas2-asf1-1 Interaction between SAS2 and ASF1 identified by Y2H 608398 N/A 608407 unspecified role unspecified role bait bait N/A 608409 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas4-sas4-1 Homodimerisation of SAS4 identified by Y2H 608398 N/A 608406 unspecified role unspecified role bait bait N/A 608406 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas4-asf1-1 Interaction between ASF1 and SAS4 identified by Y2H 608398 N/A 608406 unspecified role unspecified role bait bait N/A 608409 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas4-cac1-1 Interaction between ASF1 and CAC1 identified by Y2H 608398 N/A 608406 unspecified role unspecified role bait bait N/A 608408 unspecified role unspecified role prey prey physical association physical association false false false Table 1 asf1-sas5-1 Interaction between ASF1 and SAS5 identified by Y2H 608398 N/A 608405 unspecified role unspecified role bait bait N/A 608409 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas5-cac1-1 Interaction between CAC1 and SAS5 identified by Y2H 608398 N/A 608405 unspecified role unspecified role bait bait N/A 608408 unspecified role unspecified role prey prey physical association physical association false false false Table 1 sas2-sas4-4 Interaction between SAS2 and SAS4 identified by coimmunoprecipitation 608399 N/A 608406 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role prey prey P40963:p.Cys106Leu zinc finger disrupted mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A, 3D, 5A sas4-sas5-2 Interaction between SAS4 and SAS5 identified by coimmunoprecipitation 608399 N/A 608406 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608405 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A sas4-sas5-3 Interaction between SAS4 and SAS5 identified by coimmunoprecipitation 608399 N/A 608406 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608405 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A sas2-cac1-3 Interaction between SAS2 and CAC1 identified by coimmunoprecipitation 608399 N/A 608408 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role prey prey physical association physical association false false false 5A sas4-cac1-2 Interaction between SAS4 and CAC1 identified by coimmunoprecipitation 608399 N/A 608406 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608408 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A sas4-cac1-3 Interaction between SAS4 and CAC1 identified by coimmunoprecipitation 608399 N/A 608408 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608406 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A sas4-asf1-2 Interaction between SAS4 and ASF1 identified by coimmunoprecipitation 608399 N/A 608409 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608406 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7A sas2-sas4-5 Interaction between SAS2 and SAS4 identified by coimmunoprecipitation 608400 N/A 608406 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role bait bait physical association physical association false false false 1A sas2-cac1-4 Interaction between SAS2 and CAC1 identified by coimmunoprecipitation 608400 N/A 608408 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role bait bait physical association physical association false false false 5A sas2-asf1-2 Interaction between SAS2 and ASF1 identified by coimmunoprecipitation 608400 N/A 608409 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role bait bait physical association physical association false false false 7A sas2-sas4-1 Interaction between SAS2 and SAS4 identified by Y2H 608401 N/A 608407 unspecified role unspecified role bait bait N/A 608406 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 sas2-cac1-2 Interaction between SAS2 and CAC1 identified by Y2H 608401 N/A 608407 unspecified role unspecified role bait bait N/A 608408 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sas2-sas5-1 Interaction between SAS2 and SAS5 identified by coimmunoprecipitation 608402 N/A 608407 unspecified role unspecified role prey prey N/A 608405 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A sas2-sas5-2 Interaction between SAS2 and SAS5 identified by coimmunoprecipitation 608403 N/A 608407 unspecified role unspecified role bait bait N/A 608405 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A sas4-sas5-4 Interaction between SAS2, SAS4 and SAS5 identified by copurification 608404 N/A 608406 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608405 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 608407 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B Complex molecular mass = approx 220 kD