IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ panisko-2001-1 Subunit interactions of yeast NAD+-specific isocitrate dehydrogenase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Panisko EA., McAlister-Henn L. henn@uthscsa.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation panisko-2001-2 Subunit interactions of yeast NAD+-specific isocitrate dehydrogenase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down weight by staining molecular weight estimation by staining weight by staining Panisko EA., McAlister-Henn L. henn@uthscsa.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation idh2_yeast Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial Isocitric dehydrogenase NAD(+)-specific ICDH IDH2 YOR136W YOR3326W O3326 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 3A48C999776CE373 idh1_yeast Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial IDH1 YNL037C N2690 Isocitric dehydrogenase NAD(+)-specific ICDH protein protein yeast Saccharomyces cerevisiae Baker's yeast MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVYEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLSTM 0932E7B3CD685240 idh1-idh2-1 Interaction between IDH1 and IDH2 identified by Y2H 596478 N/A 596480 unspecified role unspecified role prey prey N/A 596481 unspecified role unspecified role bait bait physical association physical association false false false Table 1 Results confirmed using alternative sets of reporter genes. idh1-idh2-2 Interaction between IDH1 and IDH2 identified by Y2H 596478 N/A 596480 unspecified role unspecified role bait bait N/A 596481 unspecified role unspecified role prey prey physical association physical association false false false Table 1 Results confirmed using alternative sets of reporter genes. idh1-idh2-3 Interaction between IDH1 and IDH2 identified by His pulldown 596479 N/A 596480 unspecified role unspecified role prey prey N/A 596481 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4 idh1-idh2-4 Interaction between IDH1 and IDH2 identified by His pulldown 596479 N/A 596480 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 596481 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4