IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ koehler-2000-1 Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation koehler-2000-2 Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation koehler-2000-3 Tim18p, a new subunit of the TIM22 complex that mediates insertion of imported proteins into the yeast mitochondrial inner membrane. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Koehler CM., Murphy MP., Bally NA., Leuenberger D., Oppliger W., Dolfini L., Junne T., Schatz G., Or E. Yeast mitochondria isolated by centrifugation followed by solubilizing with digitonin eran_or@hms.harvard.edu Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation tim10_yeast Mitochondrial import inner membrane translocase subunit TIM10 MRS11 YHR005BC YHR005C-A TIM10 Mitochondrial intermembrane protein MRS11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF 70DD4764B944FF17 tim18_yeast Mitochondrial import inner membrane translocase subunit TIM18 TIM18 YOR297C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLLFPGLKPVLNASTVIVNPVRAVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEFSQFKDSYQKDYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDYIPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLWNENDDHLYIFGRN FE5DBEF3E3446CF7 tim54_yeast Mitochondrial import inner membrane translocase subunit TIM54 J1150 YJL054W TIM54 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSESGKPIAKPIRKPGYTNPALKALGIPALRLPSRNWMIFWSVLTVSIGGIAYDKYKQRQILSHATDLVKPLAEESMEVDKVPRKITVFIAPPPNDYLESSLKVWRRYVKPVLYYAGLDYELVQEDRQGIIRTNVANRIRELRKEILASTDGQPVKEPNQTVAKPSGSSTSKISSLLPFNKIIQDPAEEDDSFDPEIGKKFKENFDWRNVIGIFYTMPKPKHIISEDALTKDPILSGGVICLGRGAYKEYIAGIHEGLLGPIEKTEKTGSTEPKMTGVVEANQIESKVSESGATELVDAEKETALEEAKVQDDLKVDEENSSEDSQKFLKPFISSDQYPDLQIASELQTPNGEFIRNPNTNIPLLINQPLLVIPIPNLIGFTTIPRRIHRFYQKRFYVEDVCSSVVNCVRQTRIRPFDIAKDIDLAKDEEKDWPQNWVKQGKEKNSEWTQELVCDPRITKHMFVYEKPPKEEPESDI tim22_yeast Mitochondrial import inner membrane translocase subunit TIM22 D0884 YDL217C TIM22 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFKE 3C94DBF31F413968 tim12_yeast Mitochondrial import inner membrane translocase subunit TIM12 TIM12 Mitochondrial regulator of splicing 5 MRS5 YBR0812 YBR091C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK 2C4B7DEE9695866D tim54-tim18-1 Identification of components of the Tim22 complex by coimmunoprecipitation 596864 N/A 596867 unspecified role unspecified role prey prey N/A 596868 unspecified role unspecified role prey prey N/A 596869 unspecified role unspecified role bait bait N/A 596870 unspecified role unspecified role prey prey association association false false false 1 tim54-tim18-2 Identification of components of the Tim22 complex by BN-PAGE 596865 N/A 596869 unspecified role unspecified role neutral component neutral component N/A 596870 unspecified role unspecified role neutral component neutral component N/A 596868 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4A Molecular weight of complex = 300kDa tim54-tim18-3 Identification of components of the Tim22 complex by BN-PAGE 596866 N/A 596868 unspecified role unspecified role prey prey N/A 596871 unspecified role unspecified role bait bait N/A 596869 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 596870 unspecified role unspecified role prey prey association association false false false 4B