IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brown-1998-3 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation brown-1998-1 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation brown-1998-2 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov A mouse 9.5-day-old-embryo cDNA library. Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation brown-1998-4 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation brown-1998-5 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation brown-1998-6 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Brown MT., Andrade J., Radhakrishna H., Donaldson JG., Cooper JA., Randazzo PA. Arf GAP activity assay. The G protein was loaded with alpha 32P GTP. After different incubation time with the GAP protein, the proteins were trapped on nitrocellulose filters. Nucleotides bound to the G protein were then quantified. fig 4 randazzo@helix.nih.gov Mol. Cell. Biol. (0270-7306) 1998 Only protein-protein interactions imex curation q9qwy8-1 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 SHAG1a ASAP1a Kiaa1249 Shag1 ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 PIP2-dependent ARF1 GAP Asap1 Ddef1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD src_chick Proto-oncogene tyrosine-protein kinase Src SRC pp60c-src Proto-oncogene c-Src protein protein chick Gallus gallus (Chicken) Chicken MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKLFGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP q9qwy8-2 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 SHAG1b ASAP1b Asap1 Ddef1 Kiaa1249 Shag1 ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 PIP2-dependent ARF1 GAP 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD crk_human Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK asap1_mouse Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 PIP2-dependent ARF1 GAP ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 Asap1 Ddef1 Kiaa1249 Shag1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein mouse Mus musculus Mouse MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDPKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIAWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKKRPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPLSSSKTANKFEGLSQQASTSSAKTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPKPVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD asap1_bovin Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 PIP2-dependent ARF1 GAP ADP-ribosylation factor-directed GTPase-activating protein 1 Development and differentiation-enhancing factor 1 ASAP1 DDEF1 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein protein protein bovin Bos taurus (Bovine) Bovine MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKESRRDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFRGEQSAGESSLEELTKAIIEDVQRLPGNDVCCDCGSAEPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCSSSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTALHYCSMYSKPECLKLLLRSKPTVDVVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLSLPGFSTPRDKQRLSYGAFTNQIFVSTSTDSPTSPIAEAPPLPPRNATKGPPGPPSTLPLSTQTSSGSSTLSKKRSPPPPPGHKRTLSDPPSPLPHGPPNKGAVPWGNDVGPSSSSKTTNKFEGLSQQSSTGSAKTALGPRVLPKLPQKVALRKTETSHHLSLDKANVPPEIFQKSSQLTELPQKPPPGDLPPKPTELAPKPPIGDLPPKPGELPPKPQLGDLPPKPQLADLPPKPQVKDLPPKPQLGELLAKPQTGDASPKAQPPLELTPKSHPADLSPNVPKQASEDTNDLTPTLPETPVPLPRKINTGKSKVRRVKTIYDCQADNDDELTFMEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD asap1-src-2 In vitro GST pull-down: bait = src, prey = ASAP1a 328059 N/A 328065 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328066 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false asap1-fyn-1 In vitro GST pull-down: bait = fyn, prey = ASAP1a 328059 N/A 328067 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 328065 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false asap1-lyn-1 In vitro GST pull-down: bait = lyn, prey = ASAP1a 328059 N/A 328065 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 328068 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false asap1-crk-1 In vitro GST pull-down: bait = crk prey = ASAP1a 328059 N/A 328069 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 328070 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false asap1-src-3 In vitro GST pull-down: bait = src, prey = ASAP1b 328059 N/A 328069 unspecified role unspecified role prey prey Q9QWY8-2:p.[Arg811Ala;Pro849Ala;Pro853Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328066 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with src. asap1-fyn-2 In vitro GST pull-down: bait = fyn, prey = ASAP1b 328059 N/A 328069 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328067 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false asap1-lyn-2 In vitro GST pull-down: bait = lyn, prey = ASAP1b 328059 N/A 328069 unspecified role unspecified role prey prey region 33p radiolabel 33p radiolabel P33 33P undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328068 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false asap1-crk-2 In vitro GST pull-down: bait = crk prey = ASAP1b 328059 N/A 328065 unspecified role unspecified role prey prey Q9QWY8-1:p.[Pro910Ala;Pro913Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QWY8-1:p.[Arg811Ala;Pro910Ala;Pro913Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9QWY8-1:p.Arg811Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328070 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with Crk. asap1-arf1-1 ASAP1 has a GTPase activator activity on Arf1 328060 N/A 328071 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 328072 enzyme enzyme unspecified role unspecified role pza domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false asap1-arf1-2 ASAP1 has a GTPase activator activity on Arf1 328060 N/A 328071 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 328069 enzyme enzyme unspecified role unspecified role human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Increased activity of Arf1 GAp activity in lysates of cells overexpressing ASAP1b. asap1-arf1-3 ASAP1 has a GTPase activator activity on Arf1 328060 N/A 328071 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 328073 enzyme enzyme unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Bovin endogenous ASAP1 is purified to homogeneity from bovin brain asap1-src-1 Y2H: bait = src, prey = ASAP1 328061 N/A 328066 unspecified role unspecified role bait bait c-term sh3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 328065 unspecified role unspecified role prey prey sid sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false asap1-src-4 In vivo Co-IP: bait = src, prey = ASAP1b 328062 N/A 328066 unspecified role unspecified role bait bait N/A 328065 unspecified role unspecified role prey prey Q9QWY8-1:p.Arg811Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9QWY8-1:p.[Pro910Ala;Pro913Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Q9QWY8-2 over-expressed P00523 over-expressed Mutation analysis in two canonical SH3 binding site (P1: arg811Ala and P2: Pro910Ala-Pro913Ala) in ASAP1b show their importance for the interaction with src. asap1-src-5 src phosphorylates in vitro ASAP1 328063 N/A 328073 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin-brain Bos taurus brain brain Brain [cerebrum] N/A 328066 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Endogenous bovin ASAP1 was purified to homogeneity from bovin brain. asap1-src-6 src phosphorylates in vivo ASAP1 328064 N/A 328069 enzyme target enzyme target substrate substrate unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 328066 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false P00523 over-expressed Q9QWY8-2 over-expressed