IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ellison-1998-1 Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down weight by staining molecular weight estimation by staining weight by staining Ellison V., Stillman B. Proteins identified by silver staining following SDS-PAGE stillman@cshl.org J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation ellison-1998-2 Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection solution sedimentati cosedimentation in solution solution sedimentati weight by staining molecular weight estimation by staining weight by staining Ellison V., Stillman B. Proteins identified by silver staining following SDS-PAGE stillman@cshl.org J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation rfc2_human Replication factor C subunit 2 Activator 1 subunit 2 Replication factor C 40 kDa subunit Activator 1 40 kDa subunit RFC2 protein protein human Homo sapiens Human MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS rfc4_human Replication factor C subunit 4 Activator 1 subunit 4 Replication factor C 37 kDa subunit Activator 1 37 kDa subunit RFC4 protein protein human Homo sapiens Human MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC rfc1_human Replication factor C subunit 1 Activator 1 subunit 1 Replication factor C large subunit Replication factor C 140 kDa subunit Activator 1 140 kDa subunit Activator 1 large subunit DNA-binding protein PO-GA RFC1 RFC140 protein protein human Homo sapiens Human MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKKAASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKKMVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKKARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHSKSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSSPAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAKTIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIGQQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK rfc5_human Replication factor C subunit 5 Activator 1 subunit 5 Replication factor C 36 kDa subunit Activator 1 36 kDa subunit RFC5 protein protein human Homo sapiens Human METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA rfc3_human Replication factor C subunit 3 RFC3 Activator 1 subunit 3 Replication factor C 38 kDa subunit Activator 1 38 kDa subunit protein protein human Homo sapiens Human MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF rfc1-rfc2-2 Reconstitution of the RFC complex 570623 N/A 570625 unspecified role unspecified role prey prey N/A 570626 unspecified role unspecified role prey prey N/A 570627 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570628 unspecified role unspecified role prey prey n/a 570629 unspecified role unspecified role prey prey association association false false false 2A rfc1-rfc2-4 Reconstitution of the RFC complex 570623 N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570625 unspecified role unspecified role prey prey N/A 570627 unspecified role unspecified role prey prey N/A 570628 unspecified role unspecified role prey prey n/a 570629 unspecified role unspecified role prey prey association association false false false 5B rfc2-rfc3-1 Reconstitution of the RFC complex in the absence of RFC1 p140 subunit 570623 N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570625 unspecified role unspecified role prey prey N/A 570628 unspecified role unspecified role prey prey n/a 570629 unspecified role unspecified role prey prey association association false false false 5B rfc2-rfc4-4 Reconstitution of the RFC complex in the absence of RFC1 p38 subunit 570623 N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570625 unspecified role unspecified role prey prey N/A 570628 unspecified role unspecified role prey prey association association false false false 5A, 5B, rfc4-rfc3-2 Reconstitution of the RFC complex in the absence of RFC1 p40 subunit 570623 N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570628 unspecified role unspecified role prey prey n/a 570629 unspecified role unspecified role prey prey association association false false false 5B rfc1-rfc3-1 Reconstitution of the RFC complex in the absence of RFC1 p36 subunit 570623 N/A 570625 unspecified role unspecified role prey prey N/A 570627 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570626 unspecified role unspecified role prey prey n/a 570629 unspecified role unspecified role prey prey association association false false false 7 rfc4-rfc3-3 Interation of RFC4 and RFC 3 identified by pulldown 570623 N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 570629 unspecified role unspecified role prey prey physical association physical association false false false 6 rfc3-rfc4-1 Interaction between RFC3 and RFC4 identified by pulldown 570623 N/A 570626 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 570629 unspecified role unspecified role bait bait physical association physical association false false false 6 rfc2-rfc4-5 Indirect interaction between RFC2 and RFC4 identified by pulldown 570623 N/A 570625 unspecified role unspecified role prey prey N/A 570626 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570628 unspecified role unspecified role ancillary ancillary association association false false false 9 rfc4-rfc5-1 Interaction of RFC1, RFC4 and RFC5 identified by pulldown 570623 N/A 570627 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570626 unspecified role unspecified role prey prey N/A 570628 unspecified role unspecified role prey prey association association false false false 7A rfc1-rfc2-3 Reconstitution of the RFC complex 570624 N/A 570627 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570625 unspecified role unspecified role neutral component neutral component N/A 570626 unspecified role unspecified role neutral component neutral component N/A 570628 unspecified role unspecified role neutral component neutral component n/a 570629 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2B Recombinant RFC was shown to support SV40 DNA synthesis and have ATPase activity in vitro rfc2-rfc3-3 Reconstitution of the RFC complex in the absence of RFC1 p140 subunit 570624 N/A 570626 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 570625 unspecified role unspecified role neutral component neutral component N/A 570628 unspecified role unspecified role neutral component neutral component n/a 570629 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2B Recombinant RFC lacking RFC1 was shown to lack SV40 DNA synthesis but retain ATPase activity in vitro