IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bardwell-1996-1 Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation bardwell-1996-3 Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation bardwell-1996-2 Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation bardwell-1996-4 Signaling in the yeast pheromone response pathway: specific and high-affinity interaction of the mitogen-activated protein (MAP) kinases Kss1 and Fus3 with the upstream MAP kinase kinase Ste7. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Bardwell L., Cook JG., Chang EC., Cairns BR., Thorner J. Complexes subjected to SDS-PAGE in a 10% polyacrylamide gel and participants identified by molecular weight. 1 and 3 jthorner@mendel.berkeley.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation ste7_yeast Serine/threonine-protein kinase STE7 STE7 D1525 YDL159W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH C8A75899CFBE8BDE kss1_yeast Mitogen-activated protein kinase KSS1 KSS1 Kinase suppressor of SST2 YGR040W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDELMKTME 5FA42161B5FD51B5 fus3_yeast Mitogen-activated protein kinase FUS3 FUS3 DAC2 YBL016W YBL0303 YBL03.21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS 5117980D20A1E7E2 ste7-kss1-1 Interaction between Ste7 and KSS1 identified by coimmunoprecipitation 338591 N/A 338595 unspecified role unspecified role bait bait in vitro In vitro N/A 338596 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false ste7-fus3-1 Interaction between Ste7 and FUS3 identified by coimmunoprecipitation 338591 N/A 338597 unspecified role unspecified role prey prey in vitro In vitro N/A 338595 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false ste7-fus3-3 Interaction between Ste7 and Fus3 identified by coimmunoprecipitation 338592 N/A 338597 unspecified role unspecified role prey prey N/A 338595 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false P06784 electroporation ste7-kss-1 Interaction between Ste7 and KSS1 identified by coimmunoprecipitation 338592 N/A 338595 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 338596 unspecified role unspecified role prey prey physical association physical association false false false P06784 electroporation ste7-fus3-2 Interaction between Ste7 and FUS3 identified by coimmunoprecipitation 338593 N/A 338597 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 338595 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false ste7-kss1-2 Phosphorylation of KSS1 by Ste7 338594 N/A 338596 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 338595 enzyme enzyme unspecified role unspecified role n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false phosphorylation phosphorylation reaction phosphorylation false false false Phosphorylation of P14681 on Thr-183 and Tyr-185