IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ de_vries-1995-3 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Vries L., Mousli M., Wurmser A., Farquhar MG. Beta-gal filter (using 5-bromo-4-chloro-3-indolyl beta-D-galactoside) and Beta-gal liquid (using O-nitrophenyl-beta-galactose) assays were used to measure strength of interactions. Tables 1 and 2 a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 de_vries-1995-1 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence De Vries L., Mousli M., Wurmser A., Farquhar MG. a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 de_vries-1995-2 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain. in vitro In vitro pull down pull down predetermined predetermined participant predetermined De Vries L., Mousli M., Wurmser A., Farquhar MG. 5A a HeLa S3 cDNA library was screened. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 gnai3_rat Guanine nucleotide-binding protein G(i) subunit alpha-3 G(i) alpha-3 Gnai3 Gnai-3 protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY rgs19_human Regulator of G-protein signaling 19 G-alpha-interacting protein RGS19 GAIP GNAI3IP protein protein human Homo sapiens Human MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA gnai2_human Guanine nucleotide-binding protein G(i) subunit alpha-2 GNAI2 GNAI2B Adenylate cyclase-inhibiting G alpha protein protein protein human Homo sapiens Human MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF gnai3-rgs19-3 GAIP specifically interacts with Gai3, as detected by yeast two hybrid. 336160 N/A 336163 unspecified role unspecified role bait bait N/A 336164 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays. GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays. rgs19-gnai2-1 Weak interaction between GAIP and Gai2 detected by yeast two hybrid 336160 N/A 336164 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 336165 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GAI2 was found to interact very weakly with GAIP. Beta-gal liquid assays estimated that the interaction produced only 6% as much Beta-gal as the rgs19-gnai3 interaction (IntAct Accession:EBI-875208) GAI2 was found to interact very weakly with GAIP. Beta-gal liquid assays estimated that the interaction produced only 6% as much Beta-gal as the rgs19-gnai3 interaction (IntAct Accession:EBI-875208) rgs19-gnai3-4 The core domain of GAIP interacts with Gai3, detected by yeast two hybrid. 336160 N/A 336163 unspecified role unspecified role prey prey N/A 336164 unspecified role unspecified role bait bait core domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays. GAI3 was found to interact strongly with GAIP - as measured by Beta-gal filter and liquid assays. gnai3-rgs19-1 Interaction of GAIP and GAI3 identified by yeast two hybrid. 336161 N/A 336164 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 336163 unspecified role unspecified role bait bait physical association physical association false false false gnai3-rgs19-2 Interaction between GAIP and Gai3 detected by coimmunoprecipitation. 336162 N/A 336163 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 336164 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false