MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint taha-2006-1 Sphingosine kinase-1 is cleaved by cathepsin B in vitro: identification of the initial cleavage sites for the protease. in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Taha TA., El-Alwani M., Hannun YA., Obeid LM. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation catb_human Cathepsin B Cathepsin B1 APP secretase CTSB CPSB protein protein human Homo sapiens Human MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI sphk1_human Sphingosine kinase 1 Acetyltransferase SPHK1 SK1 SPHK SPHK1 SPK protein protein human Homo sapiens Human MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL ctsb-sphk1 573436 catb_human Cathepsin B 573437 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified sphk1_human SK1 573438 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false F2 F1 homomint mint ctsb-sphk1-1 573436 sphk1_human SK1 573438 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false catb_human Cathepsin B 573437 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false F3 F4 homomint mint ctsb-sphk1-2 573436 catb_human Cathepsin B 573437 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified sphk1_human SK1 573438 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false F3 F4 homomint mint ctsb-sphk1-3 573436 sphk1_human SK1 573438 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false catb_human Cathepsin B 573437 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false F4 F3 homomint mint