MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint vetsch-2006-1 Mechanism of fibre assembly through the chaperone-usher pathway. in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Vetsch M., Erilov D., Molière N., Nishiyama M., Ignatov O., Glockshuber R. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation vetsch-2006-2 Mechanism of fibre assembly through the chaperone-usher pathway. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Vetsch M., Erilov D., Molière N., Nishiyama M., Ignatov O., Glockshuber R. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation q83um2_ecolx fimA ACN002_4580 BN17_43281 protein protein ecolx Escherichia coli MKIKTLAIVVLSALSLSSTAALAAATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALALDGATFSSETTLNNGTNTIPFQARYFATGAATSGAANADATFKVQYQ mint fimc_ecoli Chaperone protein FimC fimC b4316 JW4279 protein protein ecoli Escherichia coli (strain K12) MSNKNVNVRKSQEITFCLLAGILMFMAMMVAGRAEAGVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME fima-fimc 499251 q83um2_ecolx 499253 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 fimc_ecoli 499254 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false F1A mint fima-fimc-1 499252 q83um2_ecolx 499253 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 fimc_ecoli 499254 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false F1C kd 50 micromolar mint