MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kim-2006l-3 Inhibition of ERK-MAP kinase signaling by RSK during Drosophila development. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kim M., Lee JH., Koh H., Lee SY., Jang C., Chung CJ., Sung JH., Blenis J., Chung J. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation kim-2006l-1 Inhibition of ERK-MAP kinase signaling by RSK during Drosophila development. drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim M., Lee JH., Koh H., Lee SY., Jang C., Chung CJ., Sung JH., Blenis J., Chung J. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation kim-2006l-2 Inhibition of ERK-MAP kinase signaling by RSK during Drosophila development. drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kim M., Lee JH., Koh H., Lee SY., Jang C., Chung CJ., Sung JH., Blenis J., Chung J. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation q24496_drome Non-specific serine/threonine protein kinase S6kII Rsk CG17596 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPLADSQKDLRQQPQQQQQQHVSSTSSSNNAEQQCSSSGLGLQLRQRMQITSSGCSSLAVTPMEHTPTEDEESGGGNSGVTSSVTTVTSSQRRQQLQQVQQQSALQAALEQHHISPTADLDSARKRPTHRTLCPPPELMELSDSESQGGVETGGRREGATGRSAPDLEDTEPLYETENEFELKEVIKEGHDKADPSQFELLRVLGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAVSRDDAFYFDVEYTSKSPRDSPGGPISASAHEIFRGFSFVAPVLLEGQCAGSNMCSTSASPLHSIAPIPAAPVGAPRTLPGVLPGNFHAEYNLLQELGRGTFSVCRLCEHRASKKHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFASTPNDSPDVILKRIGSGQIDFTSSRWALISVPAKELLRQMLHIVPENRPTAARILEHDWLREQFAGGVQLTEYAVAPGSQLSLCAQQQQQNHISMALRGAVDATFRAIAIPQAANVGPVELSMLAKRRAKDRANLHS rs6_drome 40S ribosomal protein S6 RpS6 l(1)air8 hen CG10944 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKLNVSYPATGCQKLFEVVDEHKLRVFYEKRMGQVVEADILGDEWKGYQLRIAGGNDKQGFPMKQGVLTHGRVRLLLKKGHSCYRPRRTGERKRKSVRGCIVDANMSVLALVVLKKGEKDIPGLTDTTIPRRLGPKRASKIRKLYNLSKEDDVRRFVVRRPLPAKDNKKATSKAPKIQRLITPVVLQRKHRRIALKKKRQIASKEASADYAKLLVQRKKESKAKREEAKRRRSASIRESKSSVSSDKK erka_drome Mitogen-activated protein kinase ERK-A Extracellular-regulated kinase A Protein rolled rl ERKa CG12559 MAPK protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKERQPDNAP s6kii-s6kii 499997 q24496_drome 500000 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 q24496_drome 500000 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F6D homomint mint rps6-s6kii 499997 rs6_drome 500001 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.0 q24496_drome 500000 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F6D homomint mint rl-s6kii 499998 q24496_drome 500000 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 erka_drome 500002 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F5B F6C homomint mint s6kii-rl 499999 q24496_drome 500000 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 erka_drome 500002 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F5C homomint mint