IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ehlert-2006-2 Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. arath-leaf Arabidopsis thaliana leaf leaf leaf 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. The GUS reporter gene activity is presented in each interaction and this should be taken into account when deciding on the interaction affinity of the interactors. However because these interactions occur 'in planta' these results may be more credible than interactions detected using a 'classical' yeast two hybrid system. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation ehlert-2006-1 Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ehlert A., Weltmeier F., Wang X., Mayer CS., Smeekens S., Vicente-Carbajosa J., Droge-Laser W. Interaction affinity was measured using beta-galactosidase assays. The authors scored '-' no interaction (nill activity), '(+)' weak interaction (2-5 x background beta gal acivity), '+' strong interaction (>5 x background beta gal activity). Directed yeast two hybrid assay. UniProt numbers were mapped using MIPs protein accession numbers where possible. Otherwise sequence data given in Figure 1 was used to perform a sequence similarity search (using MPsrch) on the UniProt database. wdroege@gwdg.de Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation bzip9_arath Basic leucine zipper 9 BZIP9 BZO2H2 Basic leucine zipper OPAQUE 2 homolog 2 F6A4.10 At5g24800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNHTAKDIGMKRSASELALQEYLTTSPLDPCFDLMNRDYTCELRDSLLWSEGLFPAGPFRDAQSSICENLSADSPVSANKPEVRGGVRRTTSGSSHVNSDDEDAETEAGQSEMTNDPNDLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQQFRSAGTNNRVLKSDVETLRVKVKLAEDLVARGSLTSSLNQLLQTHLSPPSHSISSLHYTGNTSPAITVHSDQSLFPGMTLSGQNSSPGLGNVSSEAVSCVSDIWP bzp10_arath Basic leucine zipper 10 BZIP10 BZO2H1 Basic leucine zipper OPAQUE 2 homolog 1 T10P11.9 At4g02640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD bzp25_arath Basic leucine zipper 25 BZIP25 BZO2H4 Basic leucine zipper OPAQUE 2 homolog 4 T14E10.190 At3g54620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHIVFSVDDLTESFWPVPAPAPSPGSSSTPSPTQNVADGMTRSQSEWAFHRLINELSGSDSSPTTNTIERSPPPVQSLSRLEETVDETEDVVEIQKPQNHRRLPVDDQGKNRNRAPSSDPVDSSAPVVVDPNQYHAILKSKLELACAAVARRVGTVKPEDSSASASNQKQAQGSIVAQTSPGASSVRFSPTTSTQKKPDVPARQTSISSRDDSDDDDLDGDADNGDPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIPFSNTPSASSSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAPDSNLYETLPHWNHKH bzp63_arath Basic leucine zipper 63 BZIP63 BZO2H3 Basic leucine zipper OPAQUE 2 homolog 3 T32B20.4 At5g28770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKVFSDEEISGNHHWSVNGMTSLNRSASEWAFNRFIQESSAAADDGESTTACGVSVSSPPNVPVDSEEYRAFLKSKLNLACAAVAMKRGTFIKPQDTSGRSDNGGANESEQASLASSKATPMMSSAITSGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDASVENRVLKANIETLRAKVKMAEETVKRLTGFNPMFHNMPQIVSTVSLPSETSNSPDTTSSQVTTPEIISSGNKGKALIGCKMNRTASMRRVESLEHLQKRIRSVGDQ bzip1_arath Basic leucine zipper 1 BZIP1 K7J8.13 At5g49450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANAEKTSSGSDIDEKKRKRKLSNRESARRSRLKKQKLMEDTIHEISSLERRIKENSERCRAVKQRLDSVETENAGLRSEKIWLSSYVSDLENMIATTSLTLTQSGGGDCVDDQNANAGIAVGDCRRTPWKLSCGSLQPMASFKT bzip2_arath bZIP transcription factor 2 BZIP2 FTM3 G-box-binding factor 5 GBF5 Protein FLORAL TRANSITION AT THE MERISTEM 3 At2g18160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSTYRSSSSSDGGNNNPSDSVVTVDERKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQAENSVLTAQMEELSTRLQSLNEIVDLVQSNGAGFGVDQIDGCGFDDRTVGIDGYYDDMNMMSNVNHWGGSVYTNQPIMANDINMY bzp11_arath bZIP transcription factor 11 BZIP11 ATB2 G-box-binding factor 6 GBF6 bZIP transcription factor ATB2 T4L20.170 At4g34590 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSSGTTSSTIQTSSGSEESLMEQRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENTEIVTSVSITTQHYLTVEAENSVLRAQLDELNHRLQSLNDIIEFLDSSNNNNNNNMGMCSNPLVGLECDDFFVNQMNMSYIMNQPLMASSDALMY bzp44_arath bZIP transcription factor 44 BZIP44 F1B16.8 At1g75390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNNKTEMGSSTSGNCSSVSTTGLANSGSESDLRQRDLIDERKRKRKQSNRESARRSRMRKQKHLDDLTAQVTHLRKENAQIVAGIAVTTQHYVTIEAENDILRAQVLELNHRLQSLNEIVDFVESSSSGFGMETGQGLFDGGLFDGVMNPMNLGFYNQPIMASASTAGDVFNC bzp53_arath bZIP transcription factor 53 BZIP53 T12C14.120 At3g62420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLQMQTSPESDNDPRYATVTDERKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDEASKKYIEMESKNNVLRAQASELTDRLRSLNSVLEMVEEISGQALDIPEIPESMQNPWQMPCPMQPIRASADMFDC q9lw45_arath bZIP42 ATBZIP42 basic leucine-zipper 42 At3g30530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQPQTDVFSLHNYLNSSILQSPYPSNFPISTPFPTNGQNPYLLYGFQSPTNNPQSMSLSSNNSTSDEAEEQQTNNNIINERKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHDKVLQENAQLKEETFELKQVISDMQIQSPFSCFRDDIIPIE q9lmy8_arath AtbZIP58 F13B4.8 bZIP58 basic leucine-zipper 58 F21F23.3 At1g13600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTIPAELTGYFHYLPPDKYNNQTPIMESEYFNMPSSPTSCSSFYHLNGLINNNNYSSSSNGQDLMTSNNSTSDEDHQQSMVIDERKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSESHELALKENAKLKEETSDLRQLISEIKSHNEDDNSFLRELEDSISNSRSDSNQSGRDFELC bzip4_arath Basic leucine zipper 4 BZIP4 T4M14.10 At1g59530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFYTNMETVHNCFNDATITGDEIIDILAFLQSDESDNPSGINEVVPVDDKKRRRTISNRESAKRSRMKKKKRFEELTEEVNRLNIRNQELKNRLANVVSCGNFISRENNRLKTESVCLEIRLLELYRFLVAMQSPISTSVNYITTLEI q8ru59_arath basic leucine-zipper 48 F3L12.14 F3L12_14 At2g04038 AtbZIP48 bZIP48 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIPAEINGYFQYLSPEYNVINMPSSPTSSLNYLNDLIINNNNYSSSSNSQDLMISNNSTSDEDHHQSIMVLDERKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQNCVLKENSKLKEEASDLRQLVCELKSNKNNNNSFPREFEDN bzip9-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP9 protein 489199 N/A 489201 unspecified role unspecified role prey prey N/A 489201 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 4 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 4 GUS/NAN units standard deviation = 1. bzip9-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role prey prey N/A 489201 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 28 GUS/NAN units standard deviation = 9. Table 2 GUS activity = 28 GUS/NAN units standard deviation = 9. bzip9-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP25 protein 489199 N/A 489201 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 19 GUS/NAN units standard deviation = 7. Table 2 GUS activity = 19 GUS/NAN units standard deviation = 7. bzip9-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP63 protein 489199 N/A 489201 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 18 GUS/NAN units standard deviation = 7. Table 2 GUS activity = 18 GUS/NAN units standard deviation = 7. bzip63-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP9 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 10 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 10 GUS/NAN units standard deviation = 1. bzip63-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role prey prey N/A 489204 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 71 GUS/NAN units standard deviation = 14. Table 2 GUS activity = 71 GUS/NAN units standard deviation = 14. bzip63-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP25 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 10 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 10 GUS/NAN units standard deviation = 1. bzip63-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP63 protein 489199 N/A 489204 unspecified role unspecified role prey prey N/A 489204 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 11 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 11 GUS/NAN units standard deviation = 1. bzip10-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP9 protein 489199 N/A 489201 unspecified role unspecified role prey prey N/A 489202 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 4 GUS/NAN units standard deviation = 0. Table 2 GUS activity = 4 GUS/NAN units standard deviation = 0. bzip10-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 2 GUS/NAN units standard deviation = 0. Table 2 GUS activity = 2 GUS/NAN units standard deviation = 0. bzip10-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP25 protein 489199 N/A 489202 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 4 GUS/NAN units standard deviation = 0. Table 2 GUS activity = 4 GUS/NAN units standard deviation = 0. bzip10-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP63 protein 489199 N/A 489204 unspecified role unspecified role prey prey N/A 489202 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 7 (GUS/NAN units) standard deviation = 2. Table 2 GUS activity = 7 (GUS/NAN units) standard deviation = 2. bzip25-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 8 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 8 GUS/NAN units standard deviation = 1. bzip25-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP9 protein 489199 N/A 489203 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 12 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 12 GUS/NAN units standard deviation = 1. bzip25-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP25protein 489199 N/A 489203 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity =11 GUS/NAN units standard deviation = 1. Table 2 GUS activity =11 GUS/NAN units standard deviation = 1. bzip25-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP63 protein 489199 N/A 489203 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 11 GUS/NAN units standard deviation = 0. Table 2 GUS activity = 11 GUS/NAN units standard deviation = 0. bzip9-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP1 protein 489199 N/A 489201 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 2 GUS/NAN units standard deviation = 0. Table 2 GUS activity = 2 GUS/NAN units standard deviation = 0. bzip9-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP2 protein 489199 N/A 489201 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 6 GUS/NAN units standard deviation = 2. Table 2 GUS activity = 6 GUS/NAN units standard deviation = 2. bzip9-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP11 protein 489199 N/A 489207 unspecified role unspecified role prey prey N/A 489201 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 7 GUS/NAN units standard deviation = 3. Table 2 GUS activity = 7 GUS/NAN units standard deviation = 3. bzip9-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP44 protein 489199 N/A 489201 unspecified role unspecified role bait bait N/A 489208 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 5 GUS/NAN units standard deviation = 2. Table 2 GUS activity = 5 GUS/NAN units standard deviation = 2. bzip9-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP9 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role prey prey N/A 489201 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 5 GUS/NAN units standard deviation = 1. Table 2 GUS activity = 5 GUS/NAN units standard deviation = 1. bzip10-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP1 protein 489199 N/A 489205 unspecified role unspecified role prey prey N/A 489202 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 10 (GUS NAN units) standard deviation = 7. Table 2 GUS activity = 10 (GUS NAN units) standard deviation = 7. bzip10-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP2 protein 489199 N/A 489202 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 9 GUS NAN units standard deviation = 7. Table 2 GUS activity = 9 GUS NAN units standard deviation = 7. bzip10-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP11 protein 489199 N/A 489202 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 7 GUS NAN units standard deviation = 5. Table 2 GUS activity = 7 GUS NAN units standard deviation = 5. bzip10-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role prey prey N/A 489202 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 6 GUS NAN units standard deviation = 4. Table 2 GUS activity = 6 GUS NAN units standard deviation = 4. bzip10-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP10 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role prey prey N/A 489202 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 15 GUS NAN units standard deviation = 7. Table 2 GUS activity = 15 GUS NAN units standard deviation = 7. bzip25-bzip1-1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP1 protein 489199 N/A 489203 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 30 GUS NAN units standard deviation = 4. Table 2 GUS activity = 30 GUS NAN units standard deviation = 4. bzip25-bzip2-1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP2 protein 489199 N/A 489206 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 50 GUS NAN units standrard deviation = 7. Table 2 GUS activity = 50 GUS NAN units standrard deviation = 7. bzip25-bzip11-1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP11 protein 489199 N/A 489207 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 35 GUS NAN units standard deviation = 10. Table 2 GUS activity = 35 GUS NAN units standard deviation = 10. bzip25-bzip44-1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 25 GUS NAN units standard deviation = 6. Table 2 GUS activity = 25 GUS NAN units standard deviation = 6. bzip25-bzip53-1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 28 GUS NAN units standard deviation = 1. Table 2 GUS activity = 28 GUS NAN units standard deviation = 1. bzip63-bzip1-1 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP1 protein 489199 N/A 489205 unspecified role unspecified role prey prey N/A 489204 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 8 GUS NAN units standard deviation = 2. Table 2 GUS activity = 8 GUS NAN units standard deviation = 2. bzip63-bzip2-1 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP2 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 11 GUS NAN units standard deviation = 3. Table 2 GUS activity = 11 GUS NAN units standard deviation = 3. bzip63-bzip11-1 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP11 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 18 GUS NAN units standard deviation = 6. Table 2 GUS activity = 18 GUS NAN units standard deviation = 6. bzip63-bzip44-2 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP44 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489208 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 13 GUS NAN units standard deviation = 8. Table 2 GUS activity = 13 GUS NAN units standard deviation = 8. bzip63-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP53 protein 489199 N/A 489204 unspecified role unspecified role bait bait N/A 489209 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 10 GUS NAN units standard deviation = 2. Table 2 GUS activity = 10 GUS NAN units standard deviation = 2. bzip1-bzip9-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP9 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS ativity = 33 GUS NAN units standard deviation = 3. Table 2 GUS ativity = 33 GUS NAN units standard deviation = 3. bzip1-bzip10-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP10 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 271 GUS NAN units standard deviation = 18. Table 2 GUS activity = 271 GUS NAN units standard deviation = 18. bzip1-bzip25-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP25 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 74 GUS NAN units standard deviation = 19. Table 2 GUS activity = 74 GUS NAN units standard deviation = 19. bzip1-bzip63-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP63 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 13 GUS NAN units standard deviation = 1. Table 2 GUS activity = 13 GUS NAN units standard deviation = 1. bzip1-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP1 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 2 GUS NAN units standard deviation = 0. Table 2 GUS activity = 2 GUS NAN units standard deviation = 0. bzip1-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP2 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 4 GUS NAN units standard deviation = 3. Table 2 GUS activity = 4 GUS NAN units standard deviation = 3. bzip1-bzip11-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP11 protein 489199 N/A 489207 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 17 GUS NAN units standard deviation = 8. Table 2 GUS activity = 17 GUS NAN units standard deviation = 8. bzip1-bzip44-1 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP44 protein 489199 N/A 489205 unspecified role unspecified role bait bait N/A 489208 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 9 GUS NAN units standard deviation = 4. Table 2 GUS activity = 9 GUS NAN units standard deviation = 4. bzip1-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 7 GUS NAN units standard deviation = 6. Table 2 GUS activity = 7 GUS NAN units standard deviation = 6. bzip2-bzip9-1 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP9 protein 489199 N/A 489201 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 55 GUS NAN units standard deviation = 0. Table 2 GUS activity = 55 GUS NAN units standard deviation = 0. bzip2-bzip10-1 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP10 protein 489199 N/A 489206 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 63 GUS NAN units standard deviation = 6. Table 2 GUS activity = 63 GUS NAN units standard deviation = 6. bzip2-bzip25-1 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP25 protein 489199 N/A 489206 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 207 GUS NAN units standard deviation = 14 . Table 2 GUS activity = 207 GUS NAN units standard deviation = 14 . bzip2-bzip63-1 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP63 protein 489199 N/A 489204 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS ativity = 50 GUS NAN units standard deviation = 0. Table 2 GUS ativity = 50 GUS NAN units standard deviation = 0. bzip2-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP1 protein 489199 N/A 489206 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 13 GUS NAN units standard devaition = 3. Table 2 GUS activity = 13 GUS NAN units standard devaition = 3. bzip2-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP2 protein 489199 N/A 489206 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 16 GUS NAN units standard devaition = 0. Table 2 GUS activity = 16 GUS NAN units standard devaition = 0. bzip2-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP11 protein 489199 N/A 489206 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 41 GUS NAN units standard deviation = 13. Table 2 GUS activity = 41 GUS NAN units standard deviation = 13. bzip2-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 10 GUS NAN units standard deviation = 1. Table 2 GUS activity = 10 GUS NAN units standard deviation = 1. bzip2-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP53 protein 489199 N/A 489206 unspecified role unspecified role bait bait N/A 489209 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 56 GUS NAN units standard deviation = 13. Table 2 GUS activity = 56 GUS NAN units standard deviation = 13. bzip11-bzip9-1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP9 protein 489199 N/A 489207 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 134 GUS NAN units standard deviation = 16. Table 2 GUS activity = 134 GUS NAN units standard deviation = 16. bzip11-bzip10-1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP10 protein 489199 N/A 489207 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 345 GUS NAN units standard deviation = 4. Table 2 GUS activity = 345 GUS NAN units standard deviation = 4. bzip11-bzip25-1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP25 protein 489199 N/A 489207 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 500 GUS NAN units standard deviation = 8. Table 2 GUS activity = 500 GUS NAN units standard deviation = 8. bzip11-bzip63-1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP63 protein 489199 N/A 489207 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 172 GUS NAN units standard deviation = 20. Table 2 GUS activity = 172 GUS NAN units standard deviation = 20. bzip11-bzip1-1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP1 protein 489199 N/A 489207 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 21 GUS NAN units standard deviation = 4. Table 2 GUS activity = 21 GUS NAN units standard deviation = 4. bzip11-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP2 protein 489199 N/A 489206 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 68 GUS NAN units standard deviation = 17. Table 2 GUS activity = 68 GUS NAN units standard deviation = 17. bzip11-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP11 protein 489199 N/A 489207 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 30 GUS NAN units standard deviation = 3. Table 2 GUS activity = 30 GUS NAN units standard deviation = 3. bzip11-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 12 GUS NAN units standard deviation = 2. Table 2 GUS activity = 12 GUS NAN units standard deviation = 2. bzip11-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 36 GUS NAN units standard deviation = 0. Table 2 GUS activity = 36 GUS NAN units standard deviation = 0. bzip44-bzip9-1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP9 protein 489199 N/A 489208 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 16 GUS/NAN units standard deviation = 4. Table 2 GUS activity = 16 GUS/NAN units standard deviation = 4. bzip44-bzip10-1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 49 GUS NAN units standard deviation = 0. Table 2 GUS activity = 49 GUS NAN units standard deviation = 0. bzip44-bzip25-1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP25 protein 489199 N/A 489203 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 189 GUS NAN units standard deviation = 8. Table 2 GUS activity = 189 GUS NAN units standard deviation = 8. bzip44-bzip63-1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP63 protein 489199 N/A 489204 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 15 GUS NAN units standard deviation = 2. Table 2 GUS activity = 15 GUS NAN units standard deviation = 2. bzip44-bzip1-1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP1 protein 489199 N/A 489208 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 3 GUS NAN units standard deviation = 0. Table 2 GUS activity = 3 GUS NAN units standard deviation = 0. bzip44-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP2 protein 489199 N/A 489208 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 3 GUS NAN units standard deviation = 1. Table 2 GUS activity = 3 GUS NAN units standard deviation = 1. bzip44-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP11 protein 489199 N/A 489207 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 3 GUS NAN units standard deviation = 1. Table 2 GUS activity = 3 GUS NAN units standard deviation = 1. bzip44-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role bait bait N/A 489208 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 2 GUS NAN units standard deviation = 2. Table 2 GUS activity = 2 GUS NAN units standard deviation = 2. bzip44-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP53 protein 489199 N/A 489208 unspecified role unspecified role bait bait N/A 489209 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 4 GUS NAN units standard deviation = 0. Table 2 GUS activity = 4 GUS NAN units standard deviation = 0. bzip53-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP1 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 8 GUS NAN units standard deviation = 1. Table 2 GUS activity = 8 GUS NAN units standard deviation = 1. bzip53-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP2 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 17 GUS NAN units standard deviation = 5. Table 2 GUS activity = 17 GUS NAN units standard deviation = 5. bzip53-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP11 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 29 GUS NAN units standard deviation = 5. Table 2 GUS activity = 29 GUS NAN units standard deviation = 5. bzip53-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP44 protein 489199 N/A 489208 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 13 GUS NAN units standard deviation = 3. Table 2 GUS activity = 13 GUS NAN units standard deviation = 3. bzip53-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP53 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489209 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 6 GUS NAN units standard deviation = 0. Table 2 GUS activity = 6 GUS NAN units standard deviation = 0. bzip53-bzip9-1 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP9 protein 489199 N/A 489201 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 102 GUS NAN units standard deviation = 4. Table 2 GUS activity = 102 GUS NAN units standard deviation = 4. bzip53-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP10 protein 489199 N/A 489202 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 176 GUS NAN units standard deviation = 35. Table 2 GUS activity = 176 GUS NAN units standard deviation = 35. bzip53-bzip25-1 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP25 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 150 GUS NAN units standard deviation = 34. Table 2 GUS activity = 150 GUS NAN units standard deviation = 34. bzip53-bzip63-1 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP63 protein 489199 N/A 489209 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. GUS activity = 33 GUS NAN units standard deviation = 12. Table 2 GUS activity = 33 GUS NAN units standard deviation = 12. bzip1-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP9 protein 489200 N/A 489205 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip1-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP10 protein 489200 N/A 489202 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip1-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP25 protein 489200 N/A 489203 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip1-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP63 protein 489200 N/A 489205 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip2-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP63 protein 489200 N/A 489206 unspecified role unspecified role bait bait N/A 489204 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip2-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP9 protein 489200 N/A 489206 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip2-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP10 protein 489200 N/A 489202 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip2-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP2 protein and bZIP25 protein 489200 N/A 489203 unspecified role unspecified role prey prey N/A 489206 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip11-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP9 protein 489200 N/A 489207 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip11-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP10 protein 489200 N/A 489202 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip11-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP25 protein 489200 N/A 489207 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip11-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP63 protein 489200 N/A 489204 unspecified role unspecified role prey prey N/A 489207 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip44-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP63 protein 489200 N/A 489204 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip44-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP9 protein 489200 N/A 489201 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip44-bzip10 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP10 protein 489200 N/A 489208 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip44-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP25 protein 489200 N/A 489208 unspecified role unspecified role bait bait N/A 489203 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip53-bzip9 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP9 protein 489200 N/A 489209 unspecified role unspecified role bait bait N/A 489201 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip53-bzip10-1 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP10 protein 489200 N/A 489209 unspecified role unspecified role bait bait N/A 489202 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip53-bzip25 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP25 protein 489200 N/A 489203 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip53-bzip63 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP63 protein 489200 N/A 489204 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip11-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP1 protein 489200 N/A 489207 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip44-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP1 protein 489200 N/A 489205 unspecified role unspecified role prey prey N/A 489208 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip1-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP11 protein 489200 N/A 489205 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip1-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP44 protein 489200 N/A 489208 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip25-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP1 protein 489200 N/A 489205 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip63-bzip1 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP1 protein 489200 N/A 489204 unspecified role unspecified role bait bait N/A 489205 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip25-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP2 protein 489200 N/A 489203 unspecified role unspecified role bait bait N/A 489206 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip63-bzip2 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP2 protein 489200 N/A 489206 unspecified role unspecified role prey prey N/A 489204 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip25-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP11 protein 489200 N/A 489203 unspecified role unspecified role bait bait N/A 489207 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip63-bzip11 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP11 protein 489200 N/A 489207 unspecified role unspecified role prey prey N/A 489204 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip25-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP44 protein 489200 N/A 489208 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip63-bzip44 Yeast 2 hybrid analysis reveals interaction between bZIP63 protein and bZIP44 protein 489200 N/A 489204 unspecified role unspecified role bait bait N/A 489208 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip25-bzip53 Yeast 2 hybrid analysis reveals interaction between bZIP25 protein and bZIP53 protein 489200 N/A 489209 unspecified role unspecified role prey prey N/A 489203 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip1-bzip42 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP42 protein 489200 N/A 489210 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip1-bzip58 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP58 protein 489200 N/A 489211 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip1-bzip4 Yeast 2 hybrid analysis reveals interaction between bZIP1 protein and bZIP4 protein 489200 N/A 489212 unspecified role unspecified role prey prey N/A 489205 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip11-bzip58 Yeast 2 hybrid analysis reveals interaction between bZIP11 protein and bZIP58 protein 489200 N/A 489207 unspecified role unspecified role bait bait N/A 489211 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip44-bzip42 Yeast 2 hybrid analysis reveals interaction between bZIP44 protein and bZIP42 protein 489200 N/A 489208 unspecified role unspecified role bait bait N/A 489210 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip53-bzip58 Yeast 2 hybrid analysis reveals interaction between bZIP53 protein and bZIP58 protein 489200 N/A 489211 unspecified role unspecified role prey prey N/A 489209 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip42-bzip42 Yeast 2 hybrid analysis reveals interaction between bZIP42 protein and bZIP42 protein 489200 N/A 489210 unspecified role unspecified role prey prey N/A 489210 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip42-bzip58 Yeast 2 hybrid analysis reveals interaction between bZIP42 protein and bZIP58 protein 489200 N/A 489211 unspecified role unspecified role prey prey N/A 489210 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip58-bzip42 Yeast 2 hybrid analysis reveals interaction between bZIP58 protein and bZIP42 protein 489200 N/A 489210 unspecified role unspecified role prey prey N/A 489211 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. high author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction '+'. Table 1 high Strong interaction '+'. bzip58-bzip58 Yeast 2 hybrid analysis reveals interaction between bZIP58 protein and bZIP58 protein 489200 N/A 489211 unspecified role unspecified role bait bait N/A 489211 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'. bzip58-bzip48 Yeast 2 hybrid analysis reveals interaction between bZIP58 protein and bZIP48 protein 489200 N/A 489213 unspecified role unspecified role prey prey N/A 489211 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction '(+)'. Table 1 Weak interaction '(+)'.