MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint potter-2006-1 Redox-responsive in vitro modulation of the signalling state of the isolated PrrB sensor kinase of Rhodobacter sphaeroides NCIB 8253. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Potter CA., Jeong EL., Williamson MP., Henderson PJ., Phillips-Jones MK. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation regb_cers4 Sensor histidine kinase RegB regB prrB RHOS4_00950 RSP_1520 Protein PrrB protein protein rhos4 Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGASVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISALALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGLYSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEELSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQAPLGEVLREAAEPHVGRGKRVEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVDDGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAADPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT mint Member of the two-component regulatory system regB/regA. Involved in the positive regulation of photosynthesis gene expression in response to anaerobiosis. Also involved in positive regulation of the cbbI and cbbII Calvin cycle CO2 fixation operons, as well as in regulation of expression of genes involved in alternative CO2 fixation pathways. Phosphorylates regA/prrA rega_cers4 Photosynthetic apparatus regulatory protein RegA Response regulator PrrA prrA RSP_1518 RHOS4_00930 regA protein protein rhos4 Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR rega-regb 490189 regb_rhos4 490190 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 rega_rhos4 490191 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F1B mint regb-regb 490189 regb_rhos4 490190 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 regb_rhos4 490190 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence self self neutral component neutral component purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F1A mint